SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027661 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027661
Domain Number 1 Region: 41-158
Classification Level Classification E-value
Superfamily C-type lectin-like 1.38e-29
Family C-type lectin domain 0.00000182
Further Details:      
 
Domain Number 2 Region: 199-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.03e-16
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 254-320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 4 Region: 512-577
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000106
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 5 Region: 377-444
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000115
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 323-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 457-523
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000032
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 8 Region: 161-195
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000795
Family EGF-type module 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027661   Gene: ENSBTAG00000020755   Transcript: ENSBTAT00000027661
Sequence length 645
Comment pep:known chromosome:UMD3.1:16:38049259:38080860:-1 gene:ENSBTAG00000020755 transcript:ENSBTAT00000027661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASCPKAIWNWRFQRAVFRTVQLLCFSVLIFEVINQKEVSAWTYHYSNKTYSWNYSRAFCQ
KYYTDLVAIQNKNEIAYLNETIPYYNSYYWIGIRKINNKWTWVGTNKTLTEEAENWADNE
PNNKRNNQDCVEIYIKSLSAPGKWNDEPCWKRKRALCYRASCQDMSCSKQGECIETIGNY
TCSCYPGFYGPECEYVRECGEFDLPQHVHMNCSHPLGNFSFNSHCSFHCAEGYALNGPSE
LECLASGIWTNSPPQCVAVQCPALKSPEQGSMSCVQSAEAFQHQSSCSFSCEEGFELVGP
EVVHCTALGVWTAPTPVCKALQCQDLPTSTKARVNCSHPFGDFRYQSTCSFTCDEGSFLV
GASVLQCLDTGNWDAPFPECQAVTCAALPNPQNGEKTCVQPLGGSSYESTCWFTCHEGFS
LSGPERLDCTPSGHWTGSPPTCEEVDTVSAPAPGVQCPTLIAPKQGTMSCQHHVRNFGLN
TTCHFGCKAGFTLLGDSALQCRPSRQWTAAAPTCRAVKCAKLPVTEPIVMNCSNPWGNFS
YGSTCSFHCPEGQLLNGSERTVCQENGQWSTTMPTCQAGPLTIQETLTYVGGAAAGTTGL
VTGSILLALLRRRCRQKDDGKSPLNPQSHLGTYGVFTNAAFDPSP
Download sequence
Identical sequences F6RMC4
ENSBTAP00000027661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]