SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027669 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027669
Domain Number 1 Region: 97-274
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.11e-53
Family F-box associated region, FBA 0.00095
Further Details:      
 
Domain Number 2 Region: 12-93
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000327
Family F-box domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027669   Gene: ENSBTAG00000009440   Transcript: ENSBTAT00000027669
Sequence length 276
Comment pep:novel chromosome:UMD3.1:15:47310397:47311224:-1 gene:ENSBTAG00000009440 transcript:ENSBTAT00000027669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YGRLNLLGPAPRVPDPHREPQEAPGRNQLPIEMLRKVLSYLPPSTLLWHCRPVCRRWRDV
VDGWDLWRSILPWKHPDLWPVISNCLPPADDPGPCILGRFCERRPIGRKLTANPAGKDLW
NCMVLSGSDSSEEEEDLGARLKTSGETSYSPAYRCWYKGEVLDLEEEGLWRELLDSGKIW
ISVCRRWTEQQGSDRMYQLVVKLLDANYAILHYFFHKRFPVRPRTGSFSFRIMHAFTNIK
KGVRFVLFDHSVEGYDSWPEQCGVCRPQSSVIVRIR
Download sequence
Identical sequences F1MHW5
ENSBTAP00000027669 ENSBTAP00000027669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]