SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027771 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027771
Domain Number 1 Region: 334-453
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 206-327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000753
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 159-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000921
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 4 Region: 125-169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000655
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027771   Gene: ENSBTAG00000020839   Transcript: ENSBTAT00000027771
Sequence length 1572
Comment pep:known_by_projection chromosome:UMD3.1:16:50705001:50803757:1 gene:ENSBTAG00000020839 transcript:ENSBTAT00000027771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFLPEAGAAGRAVALALVLLLPAVPTGAGALLRLQPGMPHVCAEQELTLVGRRQPCVRA
FSRTVPVWRPGCGRQAWCVSHERRTVYYTGYRQVYSTEAQTVFRCCPGWSQQPGSQGCLS
HVNECATGNAGCEGECHNTVGGFYCRCPPGRQLQGDGKTCRDVDECQVHNGGCQHRCVNT
PGSYFCECKPGFRLHADGRTCLAINSCAVGNGGCQHNCVQLTVTQHRCQCRPEFQLQEDG
RRCVRRNPCADRNGGCMHRCRALRGLAHCECRAGYQLAVDRKACEDVDECATGLAQCAHG
CLNTHGSFKCVCNAGYELGADGRQCYRIEMEIVNSCEADNGGCSHGCSHSSAGPVCTCPH
GYELDEDQRTCIDVDDCAASPCCQQVCTNSPGGYECSCYAGYRLSADGCGCEDVDECASG
RGGCEHHCANLAGSFQCSCEAGYQLDEDRRGCTSLELPELVLDGHLPLGRPPLHVAVLQD
ELPHLFQDDYVGAEEEEAEARGEHTLQEKYVCLDDTFGPDCSLTCDDCRNGGTCLPTLDS
CDCPDGWTGLVCNETCPPDTFGKNCSFSCSCQNGGTCDPVTGACRCPPGVGGAHCEDGCP
KGFYGKHCRKKCHCANRGRCHRLYGACLCDPGLYGRFCHLACPPWAFGPGCSEECKCEQQ
NTRACDKRDGSCACKAGFRGEWCQDECQPGFFGPGCRQACTCPPGVACDPVSGECGKQCP
AGYHGEDCGQECPAGTFGQNCSGSCSCGDAPCDRVTGQCLCPPGRTGDDCGADCPEGRWG
LGCQEICPPCEHGAACVPETGACLCRPGFMGSRCQDACPAGWFGPGCQTQCSCANDGLCH
PVTGRCSCAPGWTGLSCQRACDSGHWGPDCSFTCNCSAGHGGCDAVSGLCVCEAGYVGPR
CEQRCPQGYFGPGCGRQCQCEHGAACDHVSGACTCPAGWRGTFCERACPAGFFGVDCGHA
CDCSAGVPCDPVSGSCLCPSGRQGPRCAQTCPAHMFGHNCSQACSCFNGASCDPVHGQCR
CGPGWTGPTCLQACPEGLYGEDCQHSCLCQNGGSCDPVSGHCTCPEGWAGLACEKECLPG
VFEVGCPHSCGCLNGGLCDPHTVHCLCPAGWTGDKCQSSCPEGTFGVLCEERCACRWGAA
CHAVTGACLCPPGWRGSRCESACPPSWFGEACAQRCQCPPGAACHHVTGECHCPPGFTGP
SCEQACPPGTFGERCGQQCHCPGENQACHPASGTCACAPGYHGAGCQQRCPPGRFGPGCE
LLCGCLNGGSCDAVTGACRCPAGFLGTDCSLACPHGRFGPGCAYVCGCGQGAACDPVTGS
CSCPPGRTGVHCEHGCPQNRFGVNCEHACSCRNGGLCHATNGSCSCGLGWTGPHCELACP
AGRYGAACSLECSCHNHGACEPTSGACRCGPGFYGQACEHSCPPGFHGAGCQQTCQCQHG
APCDPVSGQCLCPAGLHGQFCERGCEPGSFGEGCGQQCDCELGVPCDPVTGHCLCPPGRT
GTTCDLGCRRGFFGPGCALHCSCGGGADCDPVSGQCLCVDGYTGPTCRQAVHTGTSLLAC
AHVHTCACAHLQ
Download sequence
Identical sequences E1BGE0
ENSBTAP00000027771 ENSBTAP00000027771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]