SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027775 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027775
Domain Number 1 Region: 120-453
Classification Level Classification E-value
Superfamily Subtilisin-like 1.14e-87
Family Subtilases 0.00000000197
Further Details:      
 
Domain Number 2 Region: 454-599
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-39
Family Proprotein convertase P-domain 0.00016
Further Details:      
 
Domain Number 3 Region: 31-103
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 1.51e-22
Family Prohormone convertase 1 pro-domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027775   Gene: ENSBTAG00000020843   Transcript: ENSBTAT00000027775
Sequence length 753
Comment pep:known chromosome:UMD3.1:7:98155674:98199486:-1 gene:ENSBTAG00000020843 transcript:ENSBTAT00000027775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRAWTLQCTAFSLFCAWCAMNSVKAKRQFVNEWAAEIPGGPEAASAIAQELGYDLLGQ
IGSLENHYLFKHRNHPRRSRRSALHITKRLSDDDRVIWAEQQYEKERSKRSVLRDSALDL
FNDPMWNQQWYLQDTRMTATLPKLDLHVIPVWQKGITGKGVVITVLDDGLEWNHTDIYAN
YDPEASYDFNDNDHDPFPRYDPTNENKHGTRCAGEIAMQANNHKCGVGVAYNSKVGGIRM
LDGIVTDAIEASSIGFNPGHVDIYSASWGPNDDGKTVEGPGRLAQKAFEYGVKQGRQGKG
SIFVWASGNGGRQGDNCDCDGYTDSIYTISISSASQQGLSPWYAEKCSSTLATSYSSGDY
TDQRITSADLHNDCTETHTGTSASAPLAAGIFALALEANPNLTWRDMQHLVVWTSEYDPL
ANNPGWKKNGAGLMVNSRFGFGLLNAKALVDLADPSTWSSVPEKKECVVKDNDFEPRALK
ANGEVIIEIPTRACEGQENAIKSLEHVQFEATIEYSRRGDLHVTLTSAAGTSTVLLAERE
RDTSPNGFKNWDFMSVHTWGENPIGTWTLRIADMSGRIQNEGRIVTWKLILHGTSSQPEH
MKQPRVYTSYNTVQNDRRGVEKVVDSGEEQPTQEGLDENAQASQSPSGSGVGGRRDELAE
GAPSEAMLRLLQSAFSKNSPSKQSPKKPPSAKPNIPYENFYEALERLNKPSQLKDSEDSL
YNDYVDGFYNTKPYKHRDDRLLQALVDLLREEN
Download sequence
Identical sequences F1MFR6
ENSBTAP00000027775 ENSBTAP00000027775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]