SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027783 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027783
Domain Number 1 Region: 81-273
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.99e-20
Family Clostridium neurotoxins, the second last domain 0.027
Further Details:      
 
Domain Number 2 Region: 591-853
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000000156
Family Rhodopsin-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027783   Gene: ENSBTAG00000013848   Transcript: ENSBTAT00000027783
Sequence length 902
Comment pep:known chromosome:UMD3.1:17:47028031:47202358:-1 gene:ENSBTAG00000013848 transcript:ENSBTAT00000027783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKLLPLCCWHSWLLLFYCDFQVRGAHTRSHVHPGFEVLASASHYWPLENVDGIHELQET
TGASRTHNLTVLPSHNSTFVYTNDSAYSNFSATVDIVEGKVNKGIYLKEGKGVTFLYYRK
NKTSCISNPAQCGPEGVSFSFFWKTQGEQSTSIPSAYGGQVISNGFKVCSRGGKGSVELY
THNKSVTWEASFSPPGHYWTHVLFTWKSEEGLKVYVNGTLRTSDPSGKASPAYGESNDNL
VLDLTKSYENRAFDEFIIWERALTPDEIAMYFTAAIGEQLSLSSTPPSFSVTPTVNTMAP
TNAYHPIITNLTEERKNFRRPGVVLSYLQNMSLSLPNKSLSEETAFNLTKTFLNTVGEVL
RLPSWTAVSEDSAVVPGLIDTIDTVMSHITYNLQASKPQVAIVGSSSMADFSVAKVLPKT
MNSSHYRFPARGQNYIEIPHEAFHSQAWTTIVGLLYHSVHYYLSNIQPASTKIAEAANYK
NCLLSATSYLISLEVSPTPKLSQNLSGSPLITVHLRHHLTQRQYTEATNESNRIFLYCAF
LDFSSGEGIWSNQGCALTEGNLSYSICRCTHLTNFAILMQVVPLELTRGHQVALSSISYI
GCSLSVLCLAITLVTFAVLSSVSTIRNQRYHIHANLSCAVLVAQVLLLISFRFEPGTAPC
QVLAMLLHYFFLSAFAWMLVEGLHLYSMVIKVFGSEDSKHRYYYGIGWGFPLLICIISIV
FAMDSYGTSKNCWLSLGNGAIWAFVAPALFIIVVNIGILIAVTRVISQISAENYKIHGDP
SAFKLTAKAVAVLLPILGTSWVFGVLAVNNQAMVFQYMFAILNSLQGFFIFLFHCLLNSE
VRAAFKHKTKVWSLTSSSSRQANVKPFSSDIMNGTRPATGSTRLSPWDKSSHSGHRVDLS
AV
Download sequence
Identical sequences A6QLU6
9913.ENSBTAP00000027783 NP_001029736.2.59421 NP_001029736.2.76553 ENSBTAP00000018394 ENSBTAP00000027783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]