SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027836 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027836
Domain Number 1 Region: 42-266
Classification Level Classification E-value
Superfamily vWA-like 1.81e-56
Family Integrin A (or I) domain 0.00019
Further Details:      
 
Domain Number 2 Region: 312-435
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000785
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 270-326
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000699
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000027836
Domain Number - Region: 445-471
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000275
Family Chicken cartilage matrix protein 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027836   Gene: ENSBTAG00000020893   Transcript: ENSBTAT00000027836
Sequence length 490
Comment pep:known_by_projection chromosome:UMD3.1:11:78889151:78907349:1 gene:ENSBTAG00000020893 transcript:ENSBTAT00000027836 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAEPTMPRHLPGLLLLLWPLLLLPPPPAAPSPMARPGLRRLGTRGPGGSPGRRGPAPAAP
ASVPYSGTGQPGGARGAGVCKSRPLDLVFIIDSSRSVRPLQFTKVKTFVSKIIDTLDIGP
MDTRVAVVNYASTVKIEFHLQTHSDKQSLKRAVARITPLSTGTMSGLAIQTAMDEAFTVE
AGARGPSSNIPKVAIIVTDGRPQDQVNEVAARARASGIELYAVGVDRADMESLKMMASEP
LDEHVFYVETYGVIEKLSSRFQETFCALDPCALGTHQCQHVCISDGEGRHHCECSQGYSL
NADKKTCSAIDKCALNTHGCEHICVNDRTGSYHCECYEGYTLNEDRKTCSAQDQCALGTH
GCQHICVNDRAGSHHCECYEGYTLNEDKKTCSVLNQCALGSHGCQHICVYDGNASYHCDC
DTGYTLNEDKKTCSAIEEARRLISTEDACACEATLAFQDKVNSYLQRLNSKSLDDILEKL
QANEYGQVHR
Download sequence
Identical sequences F1MD94
ENSBTAP00000027836 9913.ENSBTAP00000027836 ENSBTAP00000027836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]