SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027838 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027838
Domain Number 1 Region: 87-190
Classification Level Classification E-value
Superfamily SRCR-like 7.46e-36
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00014
Further Details:      
 
Domain Number 2 Region: 199-316
Classification Level Classification E-value
Superfamily SRCR-like 7.72e-26
Family Scavenger receptor cysteine-rich (SRCR) domain 0.001
Further Details:      
 
Domain Number 3 Region: 21-73
Classification Level Classification E-value
Superfamily SRCR-like 0.00000379
Family Scavenger receptor cysteine-rich (SRCR) domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027838   Gene: ENSBTAG00000020895   Transcript: ENSBTAT00000027838
Sequence length 536
Comment pep:known chromosome:UMD3.1:26:19201799:19214350:-1 gene:ENSBTAG00000020895 transcript:ENSBTAT00000027838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKVWDSKMKDPNSRLKSLTKKNSFWIHRVNCLGTEPHMANCQVQVAPAQGKLRPACPGGM
HAVVSCVAGPRFRPPKAKPGRKESRAEEMKVRLRSGAQVGEGRVEVLMNRQWGTVCDHGW
NLISASVVCRQLGFGSAREALFGAQLGQALGPIHLSEVRCRGYERTLSDCPSLEGSQNGC
QHDNDAAVRCNIPNMGFQDQVRLAGGRSPEEGVVEVQVEVNGVQRWGAVCSDHWGLSEAM
VACRQLGLGFASHAIKDTWYWQGTPGAREVVMSGVHCSGTELALQQCQRHGPVHCSHGTG
RFSAGVSCTDSAPDLVMNAQLVQETAYLEDRPLSLLYCAHEENCLSQSADRMDWPYGHRR
LLRFSSQIHNLGRADFRPKMGRHGWIWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKAS
FCLEDTNCPTGMQRRYACANFGEQGVTVGCWDTYRHDIDCQWVDITDVGPGDYIFQVVVN
PKFEVAESDFSNNMMRCRCKYDGQRVWLHNCHTGDSYRANTELSQEQEQRLRNNLI
Download sequence
Identical sequences G1K200
ENSBTAP00000027838 ENSBTAP00000027838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]