SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027839 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027839
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-34
Family Galectin (animal S-lectin) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027839   Gene: ENSBTAG00000020896   Transcript: ENSBTAT00000027839
Sequence length 144
Comment pep:known chromosome:UMD3.1:25:41349162:41350363:1 gene:ENSBTAG00000020896 transcript:ENSBTAT00000027839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRLQFEAFHAGGLAPGWNLLVQGHSDSGEDQFEINFLSETGDIVFHIKPRFSSATMVANA
FQGGRWGQEEASSIFPLVLGEPFEMEVSSDAEHFHVHAQEHKVLQFAHRHRPLAAITRVQ
VLSDHRLAQVELARKGLSWGAGGY
Download sequence
Identical sequences E1BEM8
ENSBTAP00000027839 ENSBTAP00000027839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]