SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027907 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027907
Domain Number 1 Region: 336-503
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.36e-57
Family SPRY domain 0.000045
Further Details:      
 
Domain Number 2 Region: 20-105
Classification Level Classification E-value
Superfamily RING/U-box 8.25e-20
Family RING finger domain, C3HC4 0.016
Further Details:      
 
Domain Number 3 Region: 125-180
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027907   Gene: ENSBTAG00000020954   Transcript: ENSBTAT00000027907
Sequence length 506
Comment pep:known_by_projection chromosome:UMD3.1:7:41718720:41731788:-1 gene:ENSBTAG00000020954 transcript:ENSBTAT00000027907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVGPRTGPGAGAEALALAAELQGEATCSICLELFREPVSVECGHSFCRACIARCWERP
GTRATAVSHTLSFSLPCPQCREPARPSQLRPNRQLAAVATLLRRFSLPAGAPGERGPPEA
VAAGCAQHGEPLKLYCQDDGRAICVVCDRAREHRAHAVLPLDEAVQEAKELLESRLKVLK
KDLEDYEAFRSTEEKESKELLKQMAAEQEKVGAEFQALRAFLVEQEGRLLGRLEELSREV
TQKQNENLAQLGDEIAQLSKLSSQIQETTCKPDLDFLQEFKNTLSRCSNVPAPKPTTVSS
EMKNKVWNASLKTFVLKGLLKKFKEDLRGELDKEEKVELTLDPDTANPRLILSLDLKSVR
LGQQAQDLPSHPRRFDTNTRVLASCGFSSGRHHWEVEVGSKDGWAFGVARESVRRKGLTP
FTPEEGVWALQLNNGQYWAVTSPERTPLSCGHLSRVRVALDLEVGAVSFYAAEDMRHIYT
FRVNFQERVFPLFSVCSTGTYLRIWP
Download sequence
Identical sequences F1MCG0
ENSBTAP00000027907 NP_001192375.1.59421 NP_001192375.1.76553 ENSBTAP00000027907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]