SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000027912 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000027912
Domain Number 1 Region: 475-825
Classification Level Classification E-value
Superfamily L domain-like 9.35e-53
Family Internalin LRR domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000027912   Gene: ENSBTAG00000020958   Transcript: ENSBTAT00000027912
Sequence length 858
Comment pep:known chromosome:UMD3.1:3:53475696:53606716:-1 gene:ENSBTAG00000020958 transcript:ENSBTAT00000027912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFTLAEVASLNDIQPTYRILKPWWDVFMDYLAVVMLMVAIFAGTMQLTKDQVVCLPVLPA
PINSKAHATPGNADITTNIPKMESATDQDQDGRMTNEISFGASAVTPDIPLRATYPHADS
TAPNQEAKKEKKDPTGRKTNLDFQQYVFINQMCYHLALPWYSKYFPYLALIHTIILMVSS
NFWFKYPKTCSKVEHFVSILGKCFESPWTTKALSETACEDSEENKQRITGAQTLPKHVST
SSDEGSPSASTPMINKTGFKFSAEKPVIEVPSMTILDKKDGEQAKALFEKVRKFRAHVED
SDLIYKLYVVQTVIKTAKFIFILCYTANFVNAISFEHVCKPKVEHLTGYEVFECTHNMAY
MLKKLLISYISIICVYGFICLYTLFWLFRIPLKEYSFEKVREESSFSDIPDVKNDFAFLL
HMVDQYDQLYSKRFGVFLSEVSENKLREISLNHEWTFEKLRQHVSRNAQDKQELHLFMLS
GVPDAVFDLTDLDVLKLELIPEAKLPAKISQMTNLQELHLCHCPAKVEQTAFSFLRDHLR
CLHVKFTDVAEIPAWVYLLKNLRELYLIGNLNSENNKMIGLESLRELRHLKILHVKSNLT
KVPSNITDVAPHLTKLVIHNDGTKLLVLNSLKKMMNVAELELQNCELERIPHAIFSLSNL
QELDLKSNNIRTIEEIISFQHLKRLTCLKLWHNKIVTIPPSITHVKNLESLYFSNNKLES
LPVAVFSLQKLRCLDVSYNNISMIPVEIGLLQNLQHLHITGNKVDVLPKQLFKCVKMRTL
NLGQNCITSLPEKIGQLSQLTQLELKGNCLDRLPAQLGQCRLLKKSGLVVEDHLFDTLPL
EVKEALNQDINIPFANGI
Download sequence
Identical sequences A4IFE5
NP_001077210.1.59421 NP_001077210.1.76553 XP_005204358.1.76553 XP_005204359.1.76553 XP_005204360.1.76553 XP_015319944.1.76553 XP_015319947.1.76553 XP_015319949.1.76553 XP_019812659.1.53367 XP_019812660.1.53367 XP_019812661.1.53367 XP_019812662.1.53367 XP_019812663.1.53367 9913.ENSBTAP00000027912 ENSBTAP00000027912 ENSBTAP00000027912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]