SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028139 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028139
Domain Number 1 Region: 107-145
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000753
Family Cripto EGF-like domain-like 0.00043
Further Details:      
 
Domain Number 2 Region: 73-104
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000008
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028139   Gene: ENSBTAG00000021119   Transcript: ENSBTAT00000028139
Sequence length 181
Comment pep:known chromosome:UMD3.1:22:53432383:53437016:-1 gene:ENSBTAG00000021119 transcript:ENSBTAT00000028139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHFSYSVILIMAFSRALELGLVAGLGDLELARPSQGELAFRDDGLWSQEEPAIRHQPSQ
FVASMGIQKSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDSRKENCGSVPHDTWLP
RKCSMCKCWHGQLRCFPQSFLPGCDGHVIDEHLTASRTPELTLSACALVLPGICLAIQSY
Y
Download sequence
Identical sequences F1N004
ENSBTAP00000028139 9913.ENSBTAP00000028139 XP_015315165.1.76553 ENSBTAP00000028139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]