SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028276 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028276
Domain Number 1 Region: 37-243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.3e-38
Family Laminin G-like module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028276   Gene: ENSBTAG00000021217   Transcript: ENSBTAT00000028276
Sequence length 1816
Comment pep:known chromosome:UMD3.1:3:40448699:40682012:1 gene:ENSBTAG00000021217 transcript:ENSBTAT00000028276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERWSSRWKTKRWLWDFTITTLALTFLFQAREVRGADPVDVLKALDFHNSPEGISKTMGF
CTNRKNSKGSDTAYRVSKQAQLSAPTKQLFSGGTFPEDFSILFTIKPQKGIQSFLLSIYN
EHGIQQIGVEVGRSPVFLYEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIV
DCKKKTTKPLDRSEKAIVDTNGIMVFGTRILDEEVFEGDIQQLLIIGDPKAAYDYCEHYS
PDCDSSAPEAAQAQEPQVDEKKKFSFKMKMKTVATNSKKKSKKFTPPKSEKFASKKKKTY
QAAAMAKLGVKANIVDDFQEYNYGTESYQTEAPRSVSGSNEPNPVEEVFTEEYLTGEDYD
SQRKNSEDMLYENKQIDGRDSDLLVDGDLGEYDFYEYKEYEDKPTSPTNEEFGPGVPAET
DITETSINGHGAYGEKGQKGEPAVVEPGMLIEGPPGPAGPAGLMGPPGLQGPTGPPGDPG
ERGPPGRPGLPGADGLPGPPGTMLVLPFRYGGDSSKGPTVSAQEAQAQAILQQARIALRG
PPGPMGLTGRPGPVGGPGSSGAKGEMGDPGPQGPRGVQGPPGPTGKPGKRGRPGADGGRG
MPGDPGATGDRGFDGLPGVAGDKCHRGERGPQGPPGPPGEDGIRGEDGEIGPRGLPGEAG
PRGLLGPRGTPGPIGQPGIAGVDGPPGPKGNMGPQGEPGPPGQQGNPGPQGLPGPQGPIG
PPGEKGPQGKPGLAGLPGADGPPGHPGKEGQSGEKGSLGPPGPQGPIGYPGPRGVKGADG
VRGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPPG
QAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRPTGPRGS
RGARGPTGKPGPKGTSGGDGPPGPPGERGPQGPQGPVGFPGPKGPPGPPGKDGLPGHPGQ
RGETGFQGKTGPPGPGGVVGPQGPTGETGPIGERGHPGPPGPPGEQGLPGAAGKEGAKGD
PGPQGVSGKDGPAGLRGFPGERGLPGAQGAPGLKGGEGPQGPPGPVGSPGERGSAGTAGP
IGLPGRPGPQGPPGPAGEKGAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGE
IGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQQGMFGQKGDEGARGF
PGPPGPIGLQGLPGPPGEKGENGDVGPMGPPGPPGPRGPQGPNGADGPQGPPGSIGSVGG
VGEKGEPGEAGNPGPPGEAGTGGPKGERGEKGEAGPPGAAGPPGAKGPPGDDGPKGNPGP
VGFPGDPGPPGEPGPAGQDGVGGDKGEDGDPGQPGPPGPSGEAGPPGPPGKRGPPGAAGA
EGRQGEKGAKGEAGAEGPPGKTGPVGPQGPAGKPGPEGLRGIPGPVGEQGLPGAAGQDGP
PGPLGPPGLPGLKGDPGSKGEKGHPGLIGLIGPPGEQGEKGDRGLPGTQGSPGAKGDGGI
PGPAGPIGPPGPPGLPGPQGPKGTKGSTGPAGQKGDSGLPGPPGPPGPPGEVIQPLPILS
PKKTRRHAESTQADAGDNILDYNDGMEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDL
QLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGGETCIYPDKKSEGVRISSWPKEKPGS
WFSEFKRGKLLSYLDIEGNSINMVQMTFLKLLTASARQNFTYYCHQSVAWYDMSSGSYDK
ALRFLGSNDEEMSYDNNPYIKALFDGCASRKGYEKTVIEINTPKIDQVPIVDVMINDFGD
QNQKFGFEVGPVCFLG
Download sequence
Identical sequences F1N0K0
ENSBTAP00000028276 ENSBTAP00000028276

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]