SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028354 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028354
Domain Number 1 Region: 284-535
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.01e-88
Family Eukaryotic proteases 0.0000591
Further Details:      
 
Domain Number 2 Region: 188-294
Classification Level Classification E-value
Superfamily SRCR-like 5.62e-19
Family Hepsin, N-terminal domain 0.06
Further Details:      
 
Domain Number 3 Region: 154-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028354   Gene: ENSBTAG00000021280   Transcript: ENSBTAT00000028354
Sequence length 539
Comment pep:known_by_projection chromosome:UMD3.1:1:144222210:144243229:-1 gene:ENSBTAG00000021280 transcript:ENSBTAT00000028354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPMVSAQPLLPLRGKGGLGTQRPRILPSLIRSSLCEPGKGCVYGKLQILGMTVPSLRSKY
SLLFPEKEVEVEVEPGLRGPEIVTMGENDPPAAEAPFSFRSLFGLDDLKISPVVPDADEV
AAQILSLLPLKFFPIIVIGIIALILALAIGLGIHFDCSGKYKCRSSFKCIELTARCDGVS
DCRDGEDEYRCVRVSGQNAVLQVFTAATWRTVCAEDWKSHHATVACAQLGFPSYVSSDTL
RVDSLEEQFREDFVSINHLLPDDKVTALHHSVYTREGCTSGHVVTLKCSACGLRTGSSPR
IVGGNTSSLAQWPWQASLQFQGYHLCGGSVITPLWVVTAAHCVYDLYLPKSWTIQVGLVS
LLDSPAPSHLVEKIIYHSKYKPKRLGNDIALMKLAGPVTFNEMTQPVCLPNSEENFPDGK
LCWTSGWGATEDGDPGDASPVLNHAAVPLISNKVCNHRDVYGGIISPSMLCAGYLKGGVD
SCQGDSGGPLVCQERRVWKLVGATSFGIGCAEVNKPGVYTRITSFLDWIHEQMERDLKT
Download sequence
Identical sequences F1MYZ1
ENSBTAP00000028354 ENSBTAP00000028354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]