SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028517 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028517
Domain Number 1 Region: 80-360
Classification Level Classification E-value
Superfamily L domain-like 3.63e-53
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 417-496
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000151
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028517   Gene: ENSBTAG00000021393   Transcript: ENSBTAT00000028517
Sequence length 660
Comment pep:known_by_projection chromosome:UMD3.1:10:98332059:98334041:1 gene:ENSBTAG00000021393 transcript:ENSBTAT00000028517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLQTTQGPGQRAFFLKSWLLISLGLSSQVSKFLACPSVCRCDRNFVYCNERSLTSVPLG
IPEGVTVLYLHNNQINNAGFPAELHNVQSVHTVYLYGNQLDEFPMNLPKNVRVLHLQENN
IQTISRAALAQLLKLEELHLDDNSISTVGVEDGAFREALSLKLLFLSKNHLSSVPVGLPV
DLQELRVDENRIAVISDMAFQNLTSLERLIVDGNLLTNKGIAEGTFGHLTKLKEFSIVRN
SLSRPPPDLPGTHLVRLYLQDNQINHIPLTAFSNLRKLERLDISNNQLRMLTQGVFDNLS
NLKQLTARNNPWFCDCSIKWVTEWLRHIPASLNVRGFMCQGPEQVRGMAVRELNMNLLSC
PTTTPGLPPLTPAPSSASPVTQPTTFSAPIPSRSYTPLSPTASKPPTIPEWDGRERVTPP
LSERIQLSIRFVNDTSIQVGWLSLFTVMAYKLTWVKMGHSLVGGIVQERIVSGEKQHLSL
VNLEPRSTYRICLVPLDAFNYRAVEDTICSEATTHDSYVNNGSNTASSHEQTTSHSLGSP
FLLAGLIGGAVIFVLVVLLSVFCWHMHRKGRYTSQKWKYNRGRRKDDYCEAGTKKDNSIL
EMTETSFQIVSLNNDQLLKGDFRLQPIYTPNGGINYTDCHIPNNMRYCNSSVPDLEHCHT
Download sequence
Identical sequences F1MVT1
ENSBTAP00000028517 XP_003582797.1.59421 XP_003586651.1.76553 XP_005193840.1.59421 XP_005212321.1.76553 XP_005901269.1.15283 XP_019824914.1.53367 XP_019824915.1.53367 ENSBTAP00000028517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]