SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028521 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028521
Domain Number 1 Region: 1024-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000954
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 984-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000117
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028521   Gene: ENSBTAG00000021396   Transcript: ENSBTAT00000028521
Sequence length 1380
Comment pep:known_by_projection chromosome:UMD3.1:1:70027330:70106415:-1 gene:ENSBTAG00000021396 transcript:ENSBTAT00000028521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ARAGAATMASPPLLLLLLPLLLLPPPAAPGTRGQPFSPAGAGPAWPTESSPGLKLPPSPT
SPPERRGPASPGHRQTAPAPGAARRPGPSSRAPRSGSAAVVKNHWLESNTEPQIENITFD
QNQVDFSTVVSKEGVMVQTPRKIHPSLDAPENITLQTETAAARGINDSSGRTEFTVPHYG
PGRTTTLTSQSSTLALGKRHPPSSSSGSEARTAPLYMESGTSWGSPAGAQGLPEEVTVHT
QMAATSVLSQSSLPAVEGGEETALPRQRSSSGPEPSWPPLSRTSAYSPPSDHPSSSGSTE
DLNNSTAVHSSSVSGTESVHVATTFPNSVQRTPQSSATSLRPLNETEHFPEDSEIAITSS
SVHSSPSEAELRRSSGVFGSPGNGAFTELSTEIAFGPTSSNISREFWQNDSPTSGGPQLA
SGSGAGNGSPVSQTETSSRSIPPVRGEESTALWFSTGSEPFAGAAGSSTSHPEVVNASVL
TRFSASAPQSQGSDPALYEMSYSELATEALSSSSSESLGFSAPRGERSTVTGISYDGASS
TDPDCRTSSEHTNYTCASSPFTKGERTLLSITDNSSSWDGRETSTSSVKISSSLSSDSSP
SSQAQTERSNVSSHQGEHAQPSTGALVLSTASSPSHTPTLNTLTTLVPRDTDAKSVGGAL
SSSSSEPPLPLPSVSQSYQFSSTLPSAGASTHRLQSSPDAPTPLSSSPPPSSVSLTASAP
ASLSDSQTALPHAPFTPVLPRTRDAPVTSVRMSAVASSIPSSQTADPPKNQSSPYLKNTV
TESKPPSLQTLPAEATKAVTVMSTLGIPSPRPFTDYSTSTDTEQTLPATSTDLAHTSPAL
AATTPETSHSPVASPSLQSSTAALTGGPTTGQTVARETEQTVVQLSPTSPEILVVQVTTE
GAVTTEESPVDRDAATRLFPLTKESTTGPGPIEDNSLASPFLKTSPSPRTTPVSTAKVLT
PPSTTSTVRSSTRSPTAPSSPAAVNSCTTHPCLHDGKCVVDLTTHPGYRCVCSPAWQGDN
CSVDVNECLSNPCPPLATCNNTQGSFTCRCPVGYQLEKGICNLVRTFVTEFKLKKTFLNT
TVEKHSDLREVENEITKMLNVCFSTLPGYTRSTAHVSRESSVVVMSLQATFSLASNVTLF
DLADRMQKCVNSCWASAEVCQLLGSQRRIFRAGSLCKRKTPECDKETSICTDLDGVALCQ
CKSGYFQFNKMDHSCRACEDGYRLENETCMSCPFGLGGLNCGNPYQLITVVIAAAGGGLL
LILGIALIVTCCRKNKNDISKLIFKSGDFQMSPYAEYPKNPRSQEWGREAIEMHENGSTK
NLLQMTDVYYSPSSVRNPELERNGLYPAYTGLPGSRHSCIFPGQYNPSFISDESRRRDYF
Download sequence
Identical sequences F1MXE0
ENSBTAP00000028521 ENSBTAP00000028521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]