SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028561 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028561
Domain Number 1 Region: 31-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-60
Family Lectin leg-like 0.00000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028561   Gene: ENSBTAG00000021425   Transcript: ENSBTAT00000028561
Sequence length 528
Comment pep:known_by_projection chromosome:UMD3.1:21:34248044:34259808:-1 gene:ENSBTAG00000021425 transcript:ENSBTAT00000028561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVRGLDPLLCLLLLVLLDPHSPEMGHLPQRRFEYKLSFKGPRLALPGVGIPFWSHHGD
AIPGLEEVRLAPSMRNRSGAVWSTNPVLFPAWEVEIQMRVTGPGRWGAQGMAVWYTRGRG
QVGPVLGEPDLGDGIGILFDSSAQDPQNSPAIYVLARDRHTLYEPLGDGGSLLLGSCRQD
FRNRPYPFRARITYWGQRLRVSLNSGLTPSGPDEVCVDVGPLLLAPGGFFGVSAATSILA
DDHDVLSFLTFSLWEPGPEPPSQPFLETEQLRLAKQLEGLQARLGLGTKEDMTPELNYGV
WEEGEQSFGLEETLHRHSQILQALQGLSKHLMQAERQWKQQLGSPGHIRPEGGWAQDSPC
QAPPTPERGGSLSRSLGKDSAKVSALLLGQRTLLQDLQEMRDAAAHMASRAQVFYLPVGT
KHHFSELAQILSLLQKDLRGPARAAAKDPRSPGRSPRVSSCLQPGIFLFFLFIQTVGFFC
YVHFSKQKLDKGLQDYLSTCSLPLSSTPQIPRVLGALRRQPFSPSIQA
Download sequence
Identical sequences E1BJ99
ENSBTAP00000028561 ENSBTAP00000028561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]