SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028604 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028604
Domain Number 1 Region: 162-294
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.71e-16
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 2 Region: 34-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000008
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 278-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000616
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028604   Gene: ENSBTAG00000021457   Transcript: ENSBTAT00000028604
Sequence length 443
Comment pep:known chromosome:UMD3.1:29:44650628:44657896:-1 gene:ENSBTAG00000021457 transcript:ENSBTAT00000028604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPFASCLPGSLLLWALLLLVLGAASPQDSEEPDSYTECTDGYEWDPDSQHCRDVNECLT
IPEACKGEMKCINHYGGYLCLPRSAAVINDLHGEGPPPPVPPAEHPHPCLPGYEPDEQER
CVDVDECAQALHDCRPSQECHNLPGSYQCTCPDGYRKIGPECVDIDECRYRYCQHRCVNL
PGSFRCQCEPGFQLGPNNRSCVDVNECDMGAPCEQRCFNSYGTFLCRCHQGYELHRDGFS
CSDIDECSYSSYLCQYRCVNEPGRFSCHCPQGYQLLATRLCQDIDECESGAHQCSEAQTC
VNFHGGYRCVDTNRCVEPYVQVSDNRCLCPASNPLCREQPSSIVHRYMSITSERSVPADV
FQIQATSVYPGAYNAFQIRAGNSQGDFYIRQINNVSAMLVLARPVTGPREYVLDLEMVTM
NSLMSYRASSVLRLTVFVGAYTF
Download sequence
Identical sequences Q0IIG2
ENSBTAP00000028604 NP_001069517.1.59421 NP_001069517.1.76553 XP_010819408.1.76553 XP_010819409.1.76553 XP_019810492.1.53367 ENSBTAP00000028604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]