SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028690 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028690
Domain Number 1 Region: 755-1051
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-80
Family Protein kinases, catalytic subunit 0.0000000000991
Further Details:      
 
Domain Number 2 Region: 113-279
Classification Level Classification E-value
Superfamily L domain-like 1.28e-51
Family L domain 0.0000000589
Further Details:      
 
Domain Number 3 Region: 275-394
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-31
Family Fibronectin type III 0.0000118
Further Details:      
 
Domain Number 4 Region: 570-712
Classification Level Classification E-value
Superfamily Fibronectin type III 1.09e-21
Family Fibronectin type III 0.0000893
Further Details:      
 
Domain Number 5 Region: 397-477,576-614
Classification Level Classification E-value
Superfamily Fibronectin type III 1.2e-21
Family Fibronectin type III 0.00019
Further Details:      
 
Domain Number 6 Region: 2-115
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000135
Family Growth factor receptor domain 0.000000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028690   Gene: ENSBTAG00000021527   Transcript: ENSBTAT00000028690
Sequence length 1154
Comment pep:known chromosome:UMD3.1:21:8208822:8268093:1 gene:ENSBTAG00000021527 transcript:ENSBTAT00000028690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCPSACGKRACTETHECCHPECLGSCSAPDNATACVACRHYYYAGVCVPSCPPNTYRFEG
WRCVDRDFCANIPNAESSDSEGFVIHDGECMQECPSGFIRNGSQSMYCIPCEGPCPKVCE
EEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRGNNIASELENFMGLIEVVTGYVKIRHS
HALVSLSFLKNLRQILGEEQLEGNYSFYVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPK
LCVSEIYRMEEVTGTKGRQSKGDINTRNNGERASCESDVLHFTSTTTSKNRIIITWHRYR
PPDYRDLISFTVYYKEAPFKNVTEYDGQDACGSNSWNMVDVDLPPNKDVEPGILLHGLKP
WTQYAVYVKAVTLTMVENDHIRGAKSEILYIRTNASVPSIPLDVLSASNSSSQLIVKWNP
PSLPNGNLSYYIVRWQRQPQDSYLYRHNYCSKDKIPIRKYADGTIDVEEVTENPKTEVCG
GEKGPCCACPKTEAEKQAEKEEAEYRKVFENFLHNAIFVPRPERKRREVMQIANTTMSSR
SRNTTVLDTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKL
GCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQV
EDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTTYENF
IHLMIALPIAVLLIVGGLVIMLYVFHRKRNSSRLGNGVLYASVNPEYFSAADVYVPDEWE
VAREKITMSRELGQGSFGMVYEGVAKGVVKDEPETRVAIKTVNEAASMRERIEFLNEASV
MKEFNCHHVVRLLGVVSQGQPTLVIMELMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMI
QMAGEIADGMAYLNANKFVHRDLAARNCMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGL
LPVRWMSPESLKDGVFTTHSDVWSFGVVLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDK
PDNCPDMLFELMRMCWQYNPKMRPSFLEIISSVKDEMEAGFREVSFYYSEENKPPEPEEL
DLEPENMESVPLDPSASSASLPLPDRHSGHKAENGPGPGVLVLRASFDERQPYAHMNGGR
KNERALPLPQSSTC
Download sequence
Identical sequences G1K218
ENSBTAP00000028690 ENSBTAP00000028690

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]