SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028721 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028721
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.49e-37
Family SPRY domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028721   Gene: ENSBTAG00000021556   Transcript: ENSBTAT00000028721
Sequence length 538
Comment pep:known_by_projection chromosome:UMD3.1:23:42736705:42795080:1 gene:ENSBTAG00000021556 transcript:ENSBTAT00000028721 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GHGKTPKDAASVRATHPIPAACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKH
SYGYHGDDGHSFCSSGTGQPYGPTFTTGDVIGCCVNLINNTCFYTKNGHSLGIAFTDLPP
NLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKTQAQIDRFPVGDREGEWQTMIQ
KMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMGEAIETTQQLY
PSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSH
GVNIHSLASGKGSTAHFSGFDNCSNGVISNKAHQAYCHSKHQPCGLNVPELNSLNTSRSQ
QVSSFTSNDVDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCG
GSQAAIERMIHFGRELQAMSEQLRRECGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDP
IQREPVCSALNSAILETHNLPKQPPLALAMGQATQCLGLMARSGIGSCAFATVDDYLH
Download sequence
Identical sequences F1MUS0
ENSBTAP00000028721 ENSBTAP00000028721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]