SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028738 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028738
Domain Number 1 Region: 125-263
Classification Level Classification E-value
Superfamily Growth factor receptor domain 4.24e-19
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 492-560
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000178
Family VWC domain 0.026
Further Details:      
 
Domain Number 3 Region: 382-440
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000209
Family VWC domain 0.029
Further Details:      
 
Domain Number 4 Region: 627-686
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000314
Family VWC domain 0.0068
Further Details:      
 
Domain Number 5 Region: 677-743
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.0053
Further Details:      
 
Domain Number 6 Region: 566-624
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000022
Family VWC domain 0.011
Further Details:      
 
Domain Number 7 Region: 433-494
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000262
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028738   Gene: ENSBTAG00000021568   Transcript: ENSBTAT00000028738
Sequence length 951
Comment pep:known_by_projection chromosome:UMD3.1:29:40475303:40505451:-1 gene:ENSBTAG00000021568 transcript:ENSBTAT00000028738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAGLLLRAACVALLLPGTPARGYTGRKTPGHFGAERRRLGPHVCLSGFGSGCCPGWAPS
MGSGHCTLPLCSFGCGSGICIAPNVCSCQDGEQGPTCPEAHGPCGEYGCDLTCNHGGCQE
VARVCPVGFSMTETAVGIRCTDIDECLSSSCEGHCVNTEGGFVCECGPGMQLSADRHSCQ
DTDECLGTPCQQRCKNSIGSYRCSCRTGFHLHGNRHSCVDVNECRRPLERRVCHHSCHNT
VGSFLCTCRPGFRLRADRVSCEAFPKAVLAPSAILQPLQHPPKMLLLLPEAGRPALSPGH
SPPSGAPGPPTGVRSTRPPPPMPALSTSSPSAPTPLLSTPVATPVPHPSLLGTLRPPAQL
QKTAVTPPLPRGPETTRLAPGPSACWHLEATYESGSRWTEPGCSQCWCEDGEVTCEKVTC
EAACSHPIPSRDGGCCPSCTGCFHSGVIRAEGDVFSPPNQNCTVCVCLAGNVSCISPECP
PDPCQASPKSDCCTCVPVRCYFHGRWYADGAVFSGGGDECTTCVCQNGEVECSFTPCPEL
DCPREEWWLGPGQCCYACREPVPMTGCSLDDNGVEFPVGQIWSPGDPCELCICQADGSVS
CKRTDCVDSCPHPIRIPGQCCPDCSAGCTYTGRIFYNNQTFPSVLDPCLSCICLLGSVAC
SPVDCPITCSYPFHPDGECCPVCQDCNYEGRKVGNGQVFTLDDEPCTQCVCQLGEVTCEK
VSCQQACSDRTMPRRDCCSSCPDSIPSLEESRALSPRGDVELSKAARSPRGDPEAPINCS
SCPGPPEVAPQRPALQLLQLLLRMNLSNPQTLPVSPSGAQASPSPSSRPGGPRASQPPQP
SLGPPIPPGASSLPPASPMAPGPPPLTPALPSSASGAHSASRRPSLPAAIPRGASALSTT
GPGASETPVTVLRPRRSSPATSRLSAALVATASPGPRQPTLGTSQEEESTV
Download sequence
Identical sequences E1BEY2
NP_001178138.1.59421 NP_001178138.1.76553 ENSBTAP00000028738 ENSBTAP00000028738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]