SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000028802 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000028802
Domain Number 1 Region: 1-112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-42
Family Galectin (animal S-lectin) 0.00000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000028802   Gene: ENSBTAG00000021615   Transcript: ENSBTAT00000028802
Sequence length 121
Comment pep:known chromosome:UMD3.1:5:109933973:109940236:-1 gene:ENSBTAG00000021615 transcript:ENSBTAT00000028802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDMKMGSSLKIKGKITDGANGFVINLGQGTDKLNLHFNPRFAESTIVCNSRDGNSWGAEQ
RDNHMCFSPGSEVKLIVTFENNEFKVKLPDGHQLTFPNRLGHSHLSYLGVQNFLVSSFKL
E
Download sequence
Identical sequences Q0VBW6
ENSBTAP00000028802 ENSBTAP00000028802 NP_001068962.1.59421 NP_001068962.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]