SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029015 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029015
Domain Number 1 Region: 104-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000441
Family EGF-type module 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029015   Gene: ENSBTAG00000021766   Transcript: ENSBTAT00000029015
Sequence length 208
Comment pep:known chromosome:UMD3.1:7:53216665:53227848:-1 gene:ENSBTAG00000021766 transcript:ENSBTAT00000029015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAGTSNLDTPTQSTDQLLPAGGGQGRE
VLDLEEANLDLFRAAFSSKPQALATPSKEERGKRKKKGKGLGKKRNPCLRRYKDFCIHGE
CKYVKELRVPTCICHPGYHGERCHGLSLPVKNRLYTYDHTTILVVVAVVLSSVCLLVIMG
LLMFWYHRRGGYDVENEEKVKLGMTTSH
Download sequence
Identical sequences E1BIN8
ENSBTAP00000029015 NP_001137562.1.59421 NP_001137562.1.76553 XP_010848652.1.44457 XP_019820604.1.53367 ENSBTAP00000029015 9913.ENSBTAP00000029015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]