SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029056 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029056
Domain Number 1 Region: 718-999
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-78
Family Protein kinases, catalytic subunit 0.00000000067
Further Details:      
 
Domain Number 2 Region: 50-217
Classification Level Classification E-value
Superfamily L domain-like 3.12e-40
Family L domain 0.000000969
Further Details:      
 
Domain Number 3 Region: 340-527
Classification Level Classification E-value
Superfamily L domain-like 8.51e-38
Family L domain 0.000000719
Further Details:      
 
Domain Number 4 Region: 513-644
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.71e-21
Family Growth factor receptor domain 0.000000214
Further Details:      
 
Domain Number 5 Region: 192-346
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.15e-16
Family Growth factor receptor domain 0.0000000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029056   Gene: ENSBTAG00000021798   Transcript: ENSBTAT00000029056
Sequence length 1257
Comment pep:known_by_projection chromosome:UMD3.1:19:40722051:40745987:1 gene:ENSBTAG00000021798 transcript:ENSBTAT00000029056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSTMELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQ
GNLELTYLPADASLSFLQEIQEVQGYVLIAHNRVSQVPLQRLRIVRGTQLFEEHYALAVL
DNGDFLESAAPAAGTAPGGLQELQLRSLTEILKGGVLIQRNPQLCHQDTILWEDIFHKNN
QLPLKQIDTNRSRACAPCSPACKAPNCWGESSQDCQSLTRTVCASGCARCKGPQPTDCCH
EQCAAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVT
ACPYNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCAPVCYGLGMEHLREVRAVT
SANIQEFAGCKKFGSLAFLPESFAGDPDSNIAPLQAEQLKVFESLEEITGYLYISAWPDS
LPDLSVFQNLRVIRGRVLHDGAYSLTLQGLGISWLGLRSLRELGSGLALIHRNARLCFVH
TVPWDQLFQNPHQALLHSANRPEDECVGEGLACYPLCAQGHCWGPGPTQCVNCSQFLRGQ
ECVEECRVLQGLPREYVKDRYCLPCHPECHPQNGSVTCFGSEADQCVACAHYKDPPFCVA
RCPSGVKPDLSFMPIWKFPDEEGICQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAV
VGVLLVVLVGLVFGILIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKET
ELRKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVG
SPYVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLED
VRLVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRR
FTHQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKC
WMIDSECRPRFRELVAEFSRMARDPQRFVVIQNEDMGPASPLDSTFYRSLLEDDDMGDLV
DAEEYLVPQQGFFCPDPAPGAAGTAHRRHRSTSTRSGGGELTLGLEPSEEEPPRSPLAPS
EGAGSDVFDGDLGMGAAKGLQPLPQHDSSPLQRYSEDPTVPLSPEADGYVAPLTCSPQPE
YVNQPEVHPQPPSPLEGPLPPPRPAGSTLERPKTLSPGKNGVVKDVFAFGAAVENPEYLA
PRGRAAPQSHPSPAFSPAFDNLYYWDQDPSERGTPPSTFEGTPTAENPEYLGLDMPV
Download sequence
Identical sequences F1MCQ7
ENSBTAP00000029056 ENSBTAP00000029056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]