SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029084 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029084
Domain Number 1 Region: 121-249
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000173
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 71-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000379
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 547-802
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000146
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029084   Gene: ENSBTAG00000021818   Transcript: ENSBTAT00000029084
Sequence length 827
Comment pep:known chromosome:UMD3.1:7:12451153:12469054:-1 gene:ENSBTAG00000021818 transcript:ENSBTAT00000029084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPHGGPFLLFHVLCFLLTLSEVGSQNSKACALPCPPNSSCVNGTACRCAPGFISFSGE
IFTDPLESCDDINECGPPSPVDCGSSADCQNTEGGYYCTCSPGYEPVSGAMIFRNESENT
CRDVDECQHRPRVCKGRSVCINTEGSYTCQCPPGLEFSPEDPRHCTDVNECTSGKKPCHS
STHCLNSVGSYECRCRPGWKPIAGSPNGPNNTVCEDVDECSSGQHQCHNSTVCFNTVGSY
TCHCREGWEPKHGLKNKQKDTICKEISFPAWTAPPGIKSRSLSAFFERVQKMSRDFKPAM
AKKSMQDLVGSVDDLLKNSGDLESLDQSSKHVTVTHLLSGLEQILRTLAKAMPKGSFTYR
SLDNTELSLVVQEQGKGNVTVGQSHARMLLDWAVAAAAEESGPTVVGILSSQNMKKLLAN
ASLKLDSEKLKETYKSPVRGAKVTLLSAVSSVFLSNTNTEKLDSNVSFAFALHEQPELKP
RQELICAFWKKDSNGNGSWATTGCWKMGRGNGSITCQCSHLSSFAILMAHYDVEDPKLAL
ITKVGLALSLACLLLCILTFLLVRPIQGSRTTVHLHLCICLFVGSAIFLAGIENEGGEVG
TRCRLVAVLLHYCFLAAFCWMSLEGVELYFLVVRVFQGQGLRKLWLCLIGYGVPLIIVGI
SAGAYSKGYGREKFCWLNFEGGFLWSFVGPVTFIVLGNAIIFVITVWKLTQKFSEINPDI
KKLKKARVLTITAIAQLFVLGCTWVFGLLLFDPESWVLSYIFSILNCLQGFFLFVLYCLL
NKKVREEYRKWACMVAGNKYSEFATTTSGSGSSHNQTQALRPSESGM
Download sequence
Identical sequences F1MCN3
9913.ENSBTAP00000029084 ENSBTAP00000029086 ENSBTAP00000029084 XP_005208660.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]