SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029086 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029086
Domain Number 1 Region: 117-157
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000246
Family EGF-type module 0.01
Further Details:      
 
Domain Number 2 Region: 71-108
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family EGF-type module 0.015
Further Details:      
 
Domain Number 3 Region: 455-709
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000146
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029086   Gene: ENSBTAG00000021818   Transcript: ENSBTAT00000029086
Sequence length 734
Comment pep:known chromosome:UMD3.1:7:12451153:12469053:-1 gene:ENSBTAG00000021818 transcript:ENSBTAT00000029086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGPHGGPFLLFHVLCFLLTLSEVGSQNSKACALPCPPNSSCVNGTACRCAPGFISFSGE
IFTDPLESCDDINECGPPSPVDCGSSADCQNTEGGYYCTCSPGYEPVSGAMIFRNESENT
CRDVDECSSGQHQCHNSTVCFNTVGSYTCHCREGWEPKHGLKNKQKDTICKEISFPAWTA
PPGIKSRSLSAFFERVQKMSRDFKPAMAKKSMQDLVGSVDDLLKNSGDLESLDQSSKHVT
VTHLLSGLEQILRTLAKAMPKGSFTYRSLDNTELSLVVQEQGKGNVTVGQSHARMLLDWA
VAAAAEESGPTVVGILSSQNMKKLLANASLKLDSEKLKETYKSPVRGAKVTLLSAVSSVF
LSNTNTEKLDSNVSFAFALHEQPELKPRQELICAFWKKDSNGNGSWATTGCWKMGRGNGS
ITCQCSHLSSFAILMAHYDVEDPKLALITKVGLALSLACLLLCILTFLLVRPIQGSRTTV
HLHLCICLFVGSAIFLAGIENEGGEVGTRCRLVAVLLHYCFLAAFCWMSLEGVELYFLVV
RVFQGQGLRKLWLCLIGYGVPLIIVGISAGAYSKGYGREKFCWLNFEGGFLWSFVGPVTF
IVLGNAIIFVITVWKLTQKFSEINPDIKKLKKARVLTITAIAQLFVLGCTWVFGLLLFDP
ESWVLSYIFSILNCLQGFFLFVLYCLLNKKVREEYRKWACMVAGNKYSEFATTTSGSGSS
HNQTQALRPSESGM
Download sequence
Identical sequences A6QNW8
ENSBTAP00000029086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]