SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029126 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029126
Domain Number 1 Region: 1478-1704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.75e-43
Family Laminin G-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 643-748
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-29
Family Cadherin 0.00073
Further Details:      
 
Domain Number 3 Region: 538-650
Classification Level Classification E-value
Superfamily Cadherin-like 1.3e-28
Family Cadherin 0.00045
Further Details:      
 
Domain Number 4 Region: 936-1048
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-28
Family Cadherin 0.00071
Further Details:      
 
Domain Number 5 Region: 321-424
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-25
Family Cadherin 0.001
Further Details:      
 
Domain Number 6 Region: 426-536
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-25
Family Cadherin 0.0009
Further Details:      
 
Domain Number 7 Region: 1036-1153
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 8 Region: 743-864
Classification Level Classification E-value
Superfamily Cadherin-like 1.24e-22
Family Cadherin 0.0016
Further Details:      
 
Domain Number 9 Region: 1721-1931
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.56e-22
Family Laminin G-like module 0.0098
Further Details:      
 
Domain Number 10 Region: 866-942
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000121
Family Cadherin 0.0047
Further Details:      
 
Domain Number 11 Region: 1417-1457
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000205
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 12 Region: 1144-1247
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000443
Family Cadherin 0.0079
Further Details:      
 
Domain Number 13 Region: 1965-2011
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000326
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 2522-2772
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000714
Family Rhodopsin-like 0.02
Further Details:      
 
Domain Number 15 Region: 1929-1963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000018
Family EGF-type module 0.023
Further Details:      
 
Domain Number 16 Region: 2059-2098
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000837
Family Laminin-type module 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029126   Gene: ENSBTAG00000021846   Transcript: ENSBTAT00000029126
Sequence length 3300
Comment pep:known_by_projection chromosome:UMD3.1:22:51793227:51818651:1 gene:ENSBTAG00000021846 transcript:ENSBTAT00000029126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMARRQPWWDLRGPTTPLLLLLSLLSLFPLSREELGDGGGHGWDPGVAAATGPGARIGNG
ALALCPEPPGVREDGEPGLGVREPVFVGLRGGRQSAQSGRGPPEQPGLGAEYGVKTFGSR
GRETGQGPGSLLCWRPEVSSCRRIGPLRRDSLSPEGLSPGVPGPENNPPFPSDLLIRPRG
SQPVSSRRNTGRGSSPKVGTTRCCGELWGPGRRGQSERTATSRARRTGPRSDRPPGAVGS
GPGLDSAPRTARTAPESGSAPRESRTAPEPTPERMRSRGLFRRRFLPQRPGPRPPGAPAR
PGAWRIPLEGRARPRRAANRHPQFPQYNYQALVPENEAAGTAVLRVVAQDPDTGEAGRLV
YSLAALMNSRSLELFSIDPQSGLIRTEAALDRESMDRHYLRVTAQDHGSPRLSATTMVAV
TVADRNDHAPVFEQAQYRETLRENVEEGYPILQLRATDGDAPPNANLRYRFVGPPAARAA
AADAFEIDPRSGLISTSGRVDREHMESYELVVEASDQGQEPGPRSATVRVHITVLDENDN
APQFSEKRYVAQVREDVRPHTVVLRVTATDRDKDANGLVHYNIISGNSRGHFAIDSLTGE
IQVVAPLDFEAEREYALRIRAQDAGRPPLSNNTGLASIQVVDINDHTPIFVSTPFQVSVL
ENAPLGHSVIHIQAVDADHGENSRLEYSLTGVAPDTPFVINSATGWVSVSGPLDRESVEH
YFFGVEARDHGSPPLSASASVTVTVLDVNDNRPEFTMKEYHLRLNEDATVGTSVVSVTAV
DRDANSAISYQITGGNTRNRFAISTQGGVGLVTLALPLDYKQERYFKLVLTASDRALHDH
CYVHINITDANTHRPVFQSAHYSVSDDVGENARITYLLEDNLPQFRIDTDSGAITLQAPL
DYEDQVTYTLAITARDNGIPQKADTTYVEVMVNDVNDNAPQFVASHYTGLVSEDAPPFTS
VLQISATDRDAHANGRVQYTFQNGEDGDGDFTIEPTSGIVRTVRRLDREAVPVYELTAYA
VDRGVPPLRTPVSIQVTVQDVNDNAPVFPAEEFEVRVKENSIVGSVVAQITAVDPDEGPN
AHIMYQIVEGNIPELFQMDIFSGELTALIDLDYEARQEYIIVVQATSAPLVSRATVHVRL
VDQNDNSPVLNNFQILFNNYVSNRSDTFPSGIIGRIPAYDPDVSDHLFYSFERGNELQLL
VVNQTSGELRLSRKLDNNRPLVASMLVTVTADGLHSVTAQCVLRVVIITEELLANSLTVR
LENMWQERFLSPLLGHFLEGVAAVLATPAEDVFIFNIQNDTDVGGTVLNVSFSALAPRGA
GAGSTGPWFSSEELQEQLYVRRAALAARSLLDVLPFDDNVCLREPCENYMKCVSVLRFDS
SAPFLASASTLFRPIQPIAGLRCRCPPGFTGDFCETELDLCYSNPCRNGGACSRREGGYT
CVCRPRFTGEDCELDTEAGRCVPGVCRNGGTCANGPDGGFRCQCPAGGAFEGPRCEVAAR
SFPPSSFVMFRGLRQRFHLTLSLSFATVQPSGLLFYNGRLNEKHDFLALELVAGQVRLTY
STGESNTVVSPTVPGGLSDGQWHTVHLRYYNKPRTDALGGAQGPSKDKVAVLSVDDCDVA
VALQFGAEIGNYSCAAAGTQTSSKKSLDLTGPLLLGGVPNLPENFPVSHKDFVGCMRDLH
IDGRRVDMASFVANNGTVAGCQAKLHFCDSGPCKNNGICSERWGGFSCDCPVGFGGKDCR
LTMAHPHHFRGNGTLSWDFGNDVAVSVPWYLGLAFRTRVKQGVLMQVQAGPHSTLLCQLD
RGLLSVTVTRASGRAAHLLLDQMIVSDGRWHDLRLELQEEPGGRRGHHVLMVSLDFSLFQ
DTLAVGSELQGLKVKQLHVGGLPHGAEEEAPQGLVGCIQGVWFGSTPSGSPALLPPSHRV
NVEPGCVVTNACASGPCPPHADCRDLWQTFSCTCWPGYYGPGCVDACLLNPCQNQGSCRH
LPGAPHGYTCDCVGGYFGHHCEHRMDQQCPRGWWGSPTCGPCNCDVHKGFDPNCNKTDGQ
CHCKEFHYRPRGSDSCLPCDCYPVGSTSRSCAPHSGQCPCRPGALGRQCNSCDSPFAEVT
ASGCRVLYDACPKSLRSGVWWPQTKFGILASVPCPRGALGAAVRLCDEDRGWLEPDLFNC
TSPAFRELNLLLDGLELNKTVLDTVEAKKLAQRLREVTGHTDHYFSQDVRVTARLLAHLL
AFESRQQGFGLTATQDAHFNENLLWAGSALLAPETGDLWAALGQRAPGGSPGSAGLVQRL
EEYAATLARNMELTYLNPVGLVTPNIMLSIDRMEHPSPTRGTRRYPRYHSNLFRGQDAWD
PHTHVLLSSQAPRPSPAEVLYPSGSSMENATTSSMAPPPAPPEPEPEPGISIVILLVYRT
LGGLLPAQFQAERRGARVPQNPVMNSPVVSVAVFHGRNFLRGVLESPISLEFRLLQTANR
SKAICVQWDPPGPADQHGLWTARDCELVHRNGSHARCRCSRTGTFGVLMDASPRERLEGD
LELLAVFTHVVMAVSVAALLLTAAVLLSLRSLKSNMRGIHANVAAALGVAELLFLLGIHR
TQNQLLCTAVAILLHYFFLGTFAWLLVQGLHLYRMQVEPRNVDRGAMRFYHALGWGVPAV
LLGLAVGLDPEGYGNPDFCWISIHDPLIWSFAGPVILVLVMNGTMFLLAARTSCSTGQRE
AKKTSVLTLRSSFLLLLLISASWLFGLLAVNHSILAFHYLHAGLCGLQGLVVLLLFCVLN
SDTRAAWTPACLGRKAAPEEARPAPGTGPGAYNNTALFEESGLIRITLGASTVSSVSSAR
SGRTQDQDSQRGRSYLRDNVLVRHGSAADHTDHGLQAHAGPTDLDVAMFHRDAGGGADSD
SDSDLSLEEERSLSIPSSESEDNGRTRGRFQRPLRRAAQSERLLTHPKDVDGNDLLSYWP
ALGECEAAPCALQTWGSERRLGLDTSKDAANNNQPDLALTSGDETSLGGAQRQRKGILKN
RLQYPLVPQTRGAPELSWCRAATLGHRAVPAASYGRICAGGGTGSLSQPASRYSSREQLD
LLLRRQLSRERLEEAPAPVLRPLSRPGSQECLDAVPGRPEPRDRGSTLPRRQPPRDHPGA
TAGRFGSRDALDRGAPCEWLRTLPPPRGARDLDPQPPPLPLSPQRQLSRDPLLPSRPLDS
LSKRSNSGEPLDHAPSRHPSREGLGPPPQLLRVREAPASGPSHGPSTEQLDILSSILASF
TSSALSSSVQSSGTPSGPHTTPTPSATASALGPSTPRSATSHSISELSPDSEVPRSEGHS
Download sequence
Identical sequences F1MHH5
ENSBTAP00000029126 ENSBTAP00000029126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]