SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029170 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029170
Domain Number 1 Region: 11-133
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.36e-16
Family Growth factor receptor domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000029170
Domain Number - Region: 112-164
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00418
Family TSP-1 type 1 repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029170   Gene: ENSBTAG00000021885   Transcript: ENSBTAT00000029170
Sequence length 205
Comment pep:known_by_projection chromosome:UMD3.1:13:60684667:60691970:1 gene:ENSBTAG00000021885 transcript:ENSBTAT00000029170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGTGPGGNCTGCVICSEENGCSTCQQRLFLFISREGIRQYGKCVHDCPPGYFGVRGQEVN
RCKKCGATCESCFSQDFCIQCKRRFYLYKGKCLPTCPPGTAAQQSTRECQEECELNPWGS
WSPCTHNGKTCGSAWGLETRVREAGRAGREEAATCQVLSESRKCPIRRPCPGERNPNRKK
GQRERRPRKDRKLDGRGDGRPRPAP
Download sequence
Identical sequences F1MH47
ENSBTAP00000029170 9913.ENSBTAP00000029170 ENSBTAP00000029170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]