SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029213 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029213
Domain Number 1 Region: 718-1011
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.14e-105
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000209
Further Details:      
 
Domain Number 2 Region: 2-258
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.27e-77
Family Carbonic anhydrase 0.00000954
Further Details:      
 
Domain Number 3 Region: 1015-1301
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.65e-74
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000159
Further Details:      
 
Domain Number 4 Region: 285-379
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000513
Family Fibronectin type III 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029213   Gene: ENSBTAG00000021911   Transcript: ENSBTAT00000029213
Sequence length 1336
Comment pep:known chromosome:UMD3.1:22:39175038:39502562:-1 gene:ENSBTAG00000021911 transcript:ENSBTAT00000029213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGAYGPEYWVTSSVSCGGRQQSPIDISDQHARVSEEYQDLQLDGFDNESSNKTWMKNTGK
TVAILLKDDYFVSGAGLPGRFKAEKVEFHWGHSNGSAGSEHSVNGRRFPVEMQIFFYNPD
DFDSFQTAISENRIIGAMAVFFQVSPRDNSALDPIIHGLKGVVHHEKETFLDPFILRDLL
PASLGSYYRYTGSLTTPPCSEIVEWIVFRRPVPISYHQLEAFYSIFTTEQQDHVKSVEYL
RNNFRPQQGLNNRVVYKSAIRDAWNHDMTDFLENPLGTEASKVCSSPPIHMKVQPLNQTA
LQVSWSQPETIYHPPIMNYMVSYSWTKNEDEKEKTFTKDSDKDLKATISHVSPDSLYLFR
VQAVCRNDMRSDFSQTMLFQANTTRIFQGTRIVKTGVPTASPASSADMAPISSGSSTWTS
SGIPFSFVSMATGMGPSSSGSQATVASVVTSTLLAGLGFSGGGISSFPSTVWPTRLPTAA
SASKQAGRPVLATTEALASPGADGDSAPSKDGEGAEESEKDEKSESEDGEREHEEEGEKD
SEKKERSGVTHAPRARNHTQPTAAPSAPGTAAQEGAHQTTSGRERARTAIPTARPQDALD
PLSVTPTQVPPTNTSGMISRPSPGRMEWIIPLIVVSALTFVCLILLIAVLVYWRGCNKIK
SKGFPRRFREVPSSGERGEKGSRKCFQTAHFYVEDSSSPRVVPNESIPIIPIPDDMEAIP
VKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPDNKHKNRYINILAYDHS
RVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGIIVM
ITNLVEKGRRKCDQYWPTENSEEYGNIIVTLKSTKVHACYTVRHFSVRNTKVKKGQKGNP
KGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARTPEMGPVLVHCSAGVGRTGT
YIVIDSMLQQIKDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAILGKETEVSS
SQLHSYVNSILIPGVGGKTRLEKQFKLVTQCNAKYVECFSAQKECNKEKNRNSSVVPSER
ARVGLAPLPGMKGTDYINASYIMGYYRSNEFIITQHPLPHTTKDFWRMIWDHNAQIIVML
PDNQSLAEDEFVYWPSREESMNCEAFTVTLISKDRLCLSNEEQIIIHDFILEATQDDYVL
EVRHFQCPKWPNPDAPISSTFELINVIKEEALTRDGPTIVHDEYGAVSAGMLCALTTLSQ
QLENENAVDVFQVAKMINLMRPGVFTDIEQYQFVYKAMLSLVSTKENGNGPMTVDRNGAA
LTADESDPAESMESLV
Download sequence
Identical sequences F1MFJ3
ENSBTAP00000029213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]