SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029222 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029222
Domain Number 1 Region: 511-699
Classification Level Classification E-value
Superfamily SET domain 1.52e-44
Family Histone lysine methyltransferases 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000029222
Domain Number - Region: 433-472
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000253
Family Myb/SANT domain 0.022
Further Details:      
 
Domain Number - Region: 118-170
Classification Level Classification E-value
Superfamily CalX-like 0.0157
Family CalX-beta domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029222   Gene: ENSBTAG00000021918   Transcript: ENSBTAT00000029222
Sequence length 707
Comment pep:known chromosome:UMD3.1:19:43395930:43428213:-1 gene:ENSBTAG00000021918 transcript:ENSBTAT00000029222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDIPNPPTSKCITYWKRKVKSEYMRLRQLKRLQANMGAKALYVANFAKVQEKTQILNEEW
KKLRVQPVQLMKPVSGHPFLKKCTIESIFPGFASQHMLMRSLNTVALVPIMYSWSPLQQN
FMVEDETVLCNIPYMGDEVKEEDETFIEELINNYDGKVHGEEEMIPGSVLISDAVFLELV
DALNQYSDEDEEGHNDTSDGKQDDSKEDLPVTRKRKRHAIEGSKKSSKKQFPNDMIFSAI
ASMFPENGVPDDMKERYRELTEMSDPNALPPQCTPNIDGPNAKSVQREQSLHSFHTLFCR
RCFKYDCFLHPFHATPNVYKRKNKEIKIEPEPCGTDCFLLLEGAKEYAMLHNPRSKCSGR
RRRRHHVVNASCSNTSASAVAETKEGDSDRDTGNDWASSSSEANSRCQTPTKQKASPAPP
QLCVVEAPSEPVEWTGAEESLFRVFHGTYFNNFCSIARLLGTKTCKQVFQFAVKESLILK
LPTDELMNPSQKKKRKHRLWAAHCRKIQLKKDNSSTQVYNYQPCDHPDRPCDSTCPCIMT
QNFCEKFCQCNPDCQNRFPGCRCKTQCNTKQCPCYLAVRECDPDLCLTCGASEHWDCKVV
SCKNCSIQRGLKKHLLLAPSDVAGWGTFIKESVQKNEFISEYCGELISQDEADRRGKVYD
KYMSSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKAKITDLKA
Download sequence
Identical sequences NP_001095621.1.59421 NP_001095621.1.76553 ENSBTAP00000029222 ENSBTAP00000029222 9913.ENSBTAP00000029222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]