SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029257 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029257
Domain Number 1 Region: 534-758
Classification Level Classification E-value
Superfamily GFP-like 7.53e-86
Family Domain G2 of nidogen-1 0.000000571
Further Details:      
 
Domain Number 2 Region: 1036-1292
Classification Level Classification E-value
Superfamily YWTD domain 1.03e-45
Family YWTD domain 0.000000112
Further Details:      
 
Domain Number 3 Region: 908-1013
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 8.63e-20
Family Thyroglobulin type-1 domain 0.001
Further Details:      
 
Domain Number 4 Region: 490-531,769-866
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-18
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 5 Region: 857-909
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000216
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029257   Gene: ENSBTAG00000021945   Transcript: ENSBTAT00000029257
Sequence length 1303
Comment pep:known chromosome:UMD3.1:10:44894657:44986659:-1 gene:ENSBTAG00000021945 transcript:ENSBTAT00000029257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGDQAAGWPAPPPLLLMLLLLLSRAAALHPSELFPYGQSRGDQLLQEGDDESSAAVKLT
LSLRFYDAQFSDLYVGTNGIISTQDFPRETQYVDDDFPTDFPAIAPFLADIDTSGGRGRV
LYRQDTSPGVLGLAASYVRTGFPLSGAHFTPTHAFLATWEQVGAYEEAKRGAPPSGELNT
FQAVLASDEFDTYALFLYPANGLQFFGTRPKESYNVQLQLPARVGFCRGEVDDLNRQGPY
FSLTSTEQSVKNLYQHSNLGIPGVWAFHIGSISPLDNVRPATIGGDLSKARPSAPLGQSF
SHAVALEDDYTQDTLDDYDENEEEIEYPPSEPAEASNGHSSVDVSLGGRISAPDSDLASP
EPRLASRSGPETESSPLDPHTKERRLQGETDAPDLKGRVESSEQPGTRVPAPPKTEGDSP
APPGEAPPPSPEGGAGPADQDALPAHPGGEAALPNYPGPDHGPHLGQRGQVVGVEDDISS
NTEVFTYNAANKETCEHNHERCSRHAFCTDYATGFCCHCQSRFYGNGKQCLPEGAPHRVN
GKVSGHLLVGHTPVHFTDVDLHAYVVGNDGRAYTAISHIPQPAAQALLPLTPIGGLFGWL
FALEKPGWENGFSLTGATFIHDVEVTFYPGEERVRITQTAEGLDPENYLSIKTNIQGQVP
YIPANFSAHVAPYKELYHYADSAVTSTSTRTYSLMSGAINQTQTYRIHQNITYQVCRHAP
RHWAVPVTQQLNVDRVFALYSDEEKVLRFAVTNQIGPVEGDSEPTPVNPCYDGSHTCATT
ARCHPATGVDYTCECASGYQGDGRNCVDVNECATGFHRCGPNSVCVNLLGSYRCECRSGY
EFADDRHTCILITPPPNPCEDGHHNCAPASQARCIHHGDGSFSCACLPGYAGDGHRCTDV
DECSENRCHPSATCSNTPGSFSCRCQPGYYGDGFQCTPEPTQRPRTVCERWRESLLEHYG
GTPRDDQYVPQCDDLGHFTPLQCHGKSDFCWCVDQDGREVQGTRSQPGITPACIPTVAPP
TVRPTPRPDVTPPPVGTFLLYAQGQQIGHLPLNGTRLQKDMAKTLLSLHGSIVVGIDYDC
RERMVYWTDVAGRTISRASLEPGAEPEMVVNSGLISPEGLAIDHFRRTMYWTDSGLDKIE
RARLDGSERRALFHTDLVNPRAIAVDPIQGNLYWTDWNREAPKIEMSSLDGENRRILVNK
DIGLPNGLTFDPFSKLLCWADAGTKKLECILPDGTGRRVIQNNLNYPFNIVSYADHFYHT
DWRRDGVIAVNRDTGQFTDEYLPEQRSHLYGITAVYPYCPGRK
Download sequence
Identical sequences F1MF97
ENSBTAP00000029257 ENSBTAP00000029257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]