SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029274 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029274
Domain Number 1 Region: 776-844
Classification Level Classification E-value
Superfamily TB module/8-cys domain 8.11e-20
Family TB module/8-cys domain 0.00052
Further Details:      
 
Domain Number 2 Region: 1692-1751
Classification Level Classification E-value
Superfamily TB module/8-cys domain 3.14e-16
Family TB module/8-cys domain 0.0014
Further Details:      
 
Domain Number 3 Region: 1249-1373
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000173
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 1039-1165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000162
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 1525-1583
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000183
Family TB module/8-cys domain 0.00025
Further Details:      
 
Domain Number 6 Region: 659-725
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000576
Family TB module/8-cys domain 0.0028
Further Details:      
 
Domain Number 7 Region: 1340-1458
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000235
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 8 Region: 725-771
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000123
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 9 Region: 993-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000305
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 10 Region: 1590-1641
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000898
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 11 Region: 1156-1206
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000352
Family EGF-type module 0.0087
Further Details:      
 
Domain Number 12 Region: 1199-1249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000671
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 1861-1960
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 14 Region: 958-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000255
Family EGF-type module 0.0089
Further Details:      
 
Domain Number 15 Region: 1452-1490
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000683
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 1634-1680
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000008
Family EGF-type module 0.0071
Further Details:      
 
Weak hits

Sequence:  ENSBTAP00000029274
Domain Number - Region: 305-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 509-539
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000709
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029274   Gene: ENSBTAG00000021957   Transcript: ENSBTAT00000029274
Sequence length 1963
Comment pep:known_by_projection chromosome:UMD3.1:10:86186700:86294121:-1 gene:ENSBTAG00000021957 transcript:ENSBTAT00000029274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWIKETKNQGEVSKNKTLQFSFRRLQRPGEGAKVQQRCAPSGRRSAASRLGARSPRPLP
PPGSGSRESLARSLTRGPLDGKRRATGRGPERSQRATGAPTVSPRGRSPRARAQLSRRPG
SMRPPTTARCPGRVLQNPWRSFWPLTLALFVGMGQAQRDPVGRYEPAGRDASRLRRPGGS
PVVATAKVYSLFREQDAPVRGSPPAELVQPSWGSPRRSTEAEARRPPRAQQPRRVQPPAQ
TWRSRPSGQQQSAPRARAAPALPRLETVQRPRAARGRLTGRNVCGGQCCPGWTTANSTNH
CIKPVCQPPCQNRGSCSRPQLCVCRSGFRGARCEEVIPEEEFDPQNSRPAPRRSAEGPPS
LRRSSVARESTTARVRPPAPQLQRARTLSGLSQTRSSQQHVGLSQTTRLYPAPAASGQLT
SNALPMGPGPERRDGAPQAAYLDRPSSSWGLNLTEKIKKIKIVFTPTICKQTCARGRCAN
SCERGDTTTLYSQSGHGHDPKSGFRIYFCQIPCLNGGRCIGRDECWCPANSTGKFCHLPA
PRLDQEPPERGPRHRAPLEGPLKQSTFTLPLSNQLASVNPSLVNVHIRHPPEASVQIHQV
ARVRGEAEEAPEENSVETRPSPRLPAGPGPGRWDSNRIPARSGEAPRLPPPVVPRTPALL
GRCYLSTLNGQCANPLPELTAHEDCCGSVGAFWGVTSCAPCPPRPASPVIENGQLECPQG
YKRLNLTHCEDVNECLTLGLCEDSECVNTRGSYLCTCRPGLLLDPSRSRCVSDKAVSMQQ
GLCYRLLGPGTCALPLAQRITKQICCCSRVGKAWGSLCEKCPLPGTEAFREICPAGHGYT
YSSSDIRLSMRKAEEEELARPSRDRGPKRNGTLPRPAERQPLRAATGTWVEAETIPDKGD
SQASQVTTSVTQLSTWVPGGALGTPTPSVPEQGIPEAREEAQVTAPTNVLVTPAPSGIDR
CAAGATNICGPGTCVNLPDGYRCICSPGYRLHPSQAYCTDDNECLRDPCKGRGRCVNRVG
SYSCFCYPGYKLATSGATQECQDIDECEQPGVCSRGRCTNTEGSYHCECDQGYIMVRKGH
CQDINECRHPGTCPDGKCVNSPGSYTCLPCEEGYRGQGGSCVDVNECLTPGVCTHGTCIN
LEGSFRCSCEQGYEVTPDEKGCQDVDECAIRASCPTGLCLNTEGSFTCSACESGYWVNED
GTACEDLDECAFPGVCPSGVCTNTAGSFSCRDCEAGYQPSALGHTCEDVDECEDPQSSCL
GGECKNTAGSYQCLCPPGFQLANGTVCEDVDECVGEEYCAPRGECLNSHGSFFCLCADGF
VSADGGTSCQDVDECAVTDRCLGGQCVNTDGSFNCVCETGFQPSPESGECVDIDECEDLG
EPICGAWRCENSPGSYRCVLGCQPGFHMAPTGDCIDIDECANDTVCGSHGFCDNTDGSFR
CLCDQGFETSPSGWDCVDVNECELMLAVCGAALCENVEGSFLCLCASDLEEYDAQEGRCR
PRGAGGPSVPEARPGAHPPGPVRMECYSGQKDQTPCSSLLGRNTTQAECCCTQGTGWGDA
CDLCPDEDSVEFSEICPSGKGYIPVEGAWMFGQTTYTDADECVMFGPGLCRNGRCLNTVP
GYICLCNPGYHYNAASRKCEDHDECQDMACENGECVNTEGSFHCFCSPPLTLDLSQQRCV
NSTSGVEDLPDHDIHMDICWKRVTNYVCSHPLHGRRTTYTECCCQDGEAWSQQCALCPPR
SSEVYAQLCNVARIEAEREAGIHFRPGYEYSPGPDDLHYSLYGPDGVPFYNYLGPEDAIP
EPLFPSTAGRPGDRIPLPEPPLQPSELQPHYVASHPGLCCCKNGEEVGSEAVSLPSSPSA
HHCQQEHQAGFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDTAHMACVDVNEC
DDLNGPAALCVHGHCENTEGSYRCHCLPGYVAEAGPPHCTAKE
Download sequence
Identical sequences F1MF86
9913.ENSBTAP00000029274 ENSBTAP00000029274 ENSBTAP00000029274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]