SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029287 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029287
Domain Number 1 Region: 227-405
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.1e-46
Family SPRY domain 0.0025
Further Details:      
 
Domain Number 2 Region: 124-233
Classification Level Classification E-value
Superfamily Fibronectin type III 7.23e-16
Family Fibronectin type III 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029287   Gene: ENSBTAG00000021968   Transcript: ENSBTAT00000029287
Sequence length 416
Comment pep:novel chromosome:UMD3.1:X:60777949:60806210:1 gene:ENSBTAG00000021968 transcript:ENSBTAT00000029287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVNTAMHEAKLMEECDELVEIIQQRKQMIAVKIKETKVMKLRKLAQQVANCRQCLERSTV
LINQAEHILKENDQARFLQSAKNIAERVAMATASSQVLIPDINFNDAFENFALDFSREKK
LLEGLDYLTAPNPPSIREELCTASHDTITVHWISDDEFSISSYELQYTIFTGQANFISLY
NSVDSWMIVPNIKQNHYTVHGLQSGTRYIFIVKAINQAGSRNSEPTRLKTNSQPFKLDPK
MTHKKLKISNDGLQMEKEESSLKKSHTPERFSGTGCYGAAGNIFIDSGCHYWEVVMGSST
WYAVGVAYKSAPKNEWIGKNASSWVFSRCNSNFVVRHNNKEMLVDVPPQLKRLGVLLDYD
NNMLSFYDPANSLHLHTFDVTFILPVCPTFTIWNKSLMILSGLPAPDFIDYPERQE
Download sequence
Identical sequences G5E5S6
ENSBTAP00000029287 9913.ENSBTAP00000029287 ENSBTAP00000029287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]