SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029302 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029302
Domain Number 1 Region: 259-437
Classification Level Classification E-value
Superfamily ITPase-like 2.14e-30
Family YjjX-like 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029302   Gene: ENSBTAG00000021977   Transcript: ENSBTAT00000029302
Sequence length 445
Comment pep:known chromosome:UMD3.1:7:27685132:27723230:-1 gene:ENSBTAG00000021977 transcript:ENSBTAT00000029302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNSGGLASAALSSSPAPLAAASTFSSPSASSVQSLPPQVYSTPQ
PSLPPVQPAAPLPFVPSSPVPSVPPLVTSLPPPASPPTAAAFSHPPLSHFPPSTSAPNTL
LSAPPSGPPTSGFSVGSTYDITRGHAGRAPQTPLMPSFSAPPVTGILPTPITQQAGLTSV
AQGTGTTSAITFPEEQEDPRIGRGQDEASAGGLWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVLGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLIVEDPVHGIHL
EAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLNVSRTDWHMAFTGMS
RRQMIYSAAKAIAGMYKQRLPPRTV
Download sequence
Identical sequences E1BLF0
ENSBTAP00000029302 ENSBTAP00000029302 NP_001192929.1.59421 NP_001192929.1.76553 XP_010805397.1.76553 XP_010844631.1.44457 9913.ENSBTAP00000029302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]