SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029325 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029325
Domain Number 1 Region: 76-141
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 8.32e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 269-314
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000838
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000374
Family Ovomucoid domain III-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029325   Gene: ENSBTAG00000021991   Transcript: ENSBTAT00000029325
Sequence length 379
Comment pep:known chromosome:UMD3.1:8:91818660:91914721:1 gene:ENSBTAG00000021991 transcript:ENSBTAT00000029325 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAVAAEAPLRLPAAPPLAFCCYTSVLLLFAFSLPGSRASNQPPGGGGGGDCPGGKGKSI
NCSELNVRESDLRVCDESSCKYGGVCKEDGDGLKCACQFQCHTNYIPVCGSNGDTYQNEC
FLRRAACKHQKEITVVARGPCYSDNGSGSGEGAEEEGSGAEVHRKHSKCGPCKYKAECDE
DAENVGCVCNIDCSGYSFNPVCASDGSSYNNPCFVREASCIKQEQIDIRHLGHCTDTDDT
SLLGKKDDGLQYRPDVKDASDQREDVYIGNHMPCPENLNGYCIHGKCEFIYSTQKASCRC
ESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAVQIAIIVAIVMCITRKCPKNNRG
RRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences E1BLD9
ENSBTAP00000029325 XP_005210535.1.76553 ENSBTAP00000029325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]