SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029353 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029353
Domain Number 1 Region: 317-494
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-37
Family SPRY domain 0.0029
Further Details:      
 
Domain Number 2 Region: 4-75
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-21
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Domain Number 3 Region: 85-143
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000321
Family B-box zinc-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029353   Gene: ENSBTAG00000022006   Transcript: ENSBTAT00000029353
Sequence length 513
Comment pep:known_by_projection chromosome:UMD3.1:19:56359579:56363139:1 gene:ENSBTAG00000022006 transcript:ENSBTAT00000029353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAQQLEDKLTCSICLELYKEPVTLLCGHNFCGACIRDWWGLCEKVCPECREPFPDGAEL
RRNVALSGVVEELRATPGPGPDPSHGARCPRHGQPLELFCRTEGLCVCCVCTVRECRLHE
RVLLDAERRAREAQLRATLEVTQQQAAQAQRQLQELQQRSSQIQNSACTLTSVISGKFSC
LLQALEMRRVRALRDINVAKTQALEQAQQEKQRLQGHLEAVSFCDRRIRHLLEHLDDWTF
LQESQQLVPPGPLGPLTLPQWDEDQQLGGLKESLSQLCALLLEEGAHSGVPTEAADLGSV
ESPGPLAPVLSPVCPLRRRLWQNYRNLTFDPVSANRHLYLSQQDQRVKHLLKPRGPDGPG
SFELWQVQCAQSFQAGQHYWEVRASSHSVTLGVAYSELTRRRQGPHTDNIGRGPSSWGLC
IQEDCTQAWHDGKAQRLPVVSGRLLGVDLNLASGCLTFYSLEPKTQPLHTFHAIFTRPLY
PIFWLLEGRTLTLCHQPEATLPPGLQEEASGLS
Download sequence
Identical sequences E1BKW8
ENSBTAP00000029353 ENSBTAP00000029353

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]