SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029478 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029478
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-26
Family Kringle modules 0.0009
Further Details:      
 
Domain Number 2 Region: 187-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-24
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029478   Gene: ENSBTAG00000009773   Transcript: ENSBTAT00000029478
Sequence length 429
Comment pep:known_by_projection chromosome:UMD3.1:17:70568207:70601539:1 gene:ENSBTAG00000009773 transcript:ENSBTAT00000029478 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFLECFTANGADYRGTQNWTALQGGKPCLFWNETFQHPYNTLKYPNGEGGVGEHNYCRNP
DGDVSPWCYVAEHEDGVYWKYCEIPTCQMPGNLGCYKDHGNPPPLTGTSKTSNKLTIQNC
ISFCRSQRFKFAGIESGYACFCGNDPDYWKYGEAASTECSSVCFGDHTQPCGGDGRVIVF
DTLVGACGGNYSAMTSVVYSPDFPDAYAAGRVCYWTIRVPGAAHIQFNFTLFDIRDSADM
VELLDGYTHRVLVRFNGRNRPPSSFNISLDFIILYFFSDRINQAQGFAVLYQAIKEDPPQ
EKPTDNQMLAEVITEQANFSVSAARSSKVLYVITTSPSHPRQTVPGWTVYGLATLLILTV
TAIVAKILLHITFRSHRVPASGDLRDCHQPGTSGEIWSIFYEPSTSISIFKKKLKCQSQP
DDRNPLVSD
Download sequence
Identical sequences F1MRR1
ENSBTAP00000029478 9913.ENSBTAP00000029478 ENSBTAP00000029478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]