SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029890 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029890
Domain Number 1 Region: 492-795
Classification Level Classification E-value
Superfamily L domain-like 2.27e-46
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 2 Region: 49-429
Classification Level Classification E-value
Superfamily RNI-like 4.71e-38
Family Cyclin A/CDK2-associated p19, Skp2 0.088
Further Details:      
 
Domain Number 3 Region: 883-1039
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-34
Family Toll/Interleukin receptor TIR domain 0.0000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029890   Gene: ENSBTAG00000022161   Transcript: ENSBTAT00000029895
Sequence length 1050
Comment pep:known chromosome:UMD3.1:X:141044355:141063596:-1 gene:ENSBTAG00000022161 transcript:ENSBTAT00000029895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPMWTLKRQFPILFNMILISGLLGARWFPKTLPCDVTLDAPNTHVIVDCTDKHLTEIP
GGIPANATNLTLTINHIAGISPASFHRLDHLVEIDFRCNCVPVRLGPKDNVCTKRLQIKP
NSFSKLTYLKSLYLDGNQLLEIPQDLPPSLQLLSLEANNIFLIMKENLTELANLEILYLG
QNCYYRNPCNVSFTIEKDAFLNMRNLKLLSLKDNNISAVPTVLPSSLTELYLYNNIITKI
QEDDFNNLSQLQVLDLSGNCPRCYNVPFPCTPCENNSPLQIDPNAFDALTELQVLRLHSN
SLQHVPQRWFKNINKLKELDLSQNFLAKEIGDAKFLHLLHNLVNLDLSFNYDLQVYHAVI
NLSDAFSSLKKLKVLRIKGYVFKELNSLNLFPLHNLPNLEVLDLGTNFIKIANLSIFNQF
KTLKFIDLSVNKISPSGDSPEGGFCSNRRTSVEGHGPQVLETLHYFRYDEYARSCRSKSK
EPPSFLPLNEDCYMYGQTLDLSRNNIFFIKPSDFQHLSFLKCLNLSGNSISQTLNGSEFQ
PLVELKYLDFSNNRLDLLYSTAFEELHNLEVLDISSNSHYFQSEGITHMLNFTKNLKVLR
KLMMNYNDIATSTSRTMESESLQILEFRGNHLDILWRDGDNRYLKFFKNLLNLEELDISE
NSLSFLPLGVFDSMPPNLKTLSLAKNGLKSFSWERLQSLKNLETLDLSFNQLKTVPERLS
NCSRSLKKLILKNNQIRCLTKYFLQGAFQLRHLDLSSNKIQVIQKTSFPENVLNNLNILF
LHHNRFLCNCDAVWFVWWVNHTEVTIPYLATDVTCMGPGAHKGQSVVSLDLYTCELDLTN
FILFSLSISAVLSLMMITIANHLYFWDVWYSYHFCKAKIKGYRRLISPNSCYDAFIVYDT
KDPAVTEWVLDELVAKLEDPREKCFNLCLEERDWLPGQPVLENLSQSIQLSKKTVFVMTD
KYAKTENFKIAFYLSHQRLMDEKVDVIILIFLEKPLQKSKFLQLRKRLCGSSVLEWPTNP
QAHPYFWQCLKNALATDNHVTYSQVFKETA
Download sequence
Identical sequences A0A2D0UYK8 A1XC24
ENSBTAP00000029890 ENSBTAP00000029890 9913.ENSBTAP00000029890 XP_005228543.1.76553 XP_005891088.1.15283 XP_010820553.1.76553 XP_015317288.1.76553 XP_019811964.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]