SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000029938 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000029938
Domain Number 1 Region: 449-590
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.11e-22
Family MAM domain 0.001
Further Details:      
 
Domain Number 2 Region: 120-235
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 243-291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000029938   Gene: ENSBTAG00000006686   Transcript: ENSBTAT00000029948
Sequence length 593
Comment pep:known_by_projection chromosome:UMD3.1:6:20450525:20529959:-1 gene:ENSBTAG00000006686 transcript:ENSBTAT00000029948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLLALLLGSSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARRPWGQCQPVC
QPQCKHGECVGPNKCKCHPGFAGKTCNQDEHLYPTPLDQGSEQPLLQPPDHPATSLPSRD
LNECGLKPRPCKHRCMNTFGSYKCYCLSGYMLLPDGSCSSALTCSMANCQYGCDVVKGQI
RCKCPSPGLQLAPDGRTCVDIDECATGRASCPRHRQCVNTFGSYICKCHKGFDLMYIGGK
YQCHDIDECSLGQYQCSSFARCYNIHGSYKCKCKDGYQGDGLNCVYIPRVMIEPSGPIHV
PKGNGTISKGDGGHGNWIPDVRSTRWPLKTPYMPPVMIDRPTSKPTARPTPKPIPEPTPP
PPPPTELRTPPPATAPERPTTRLTTVAPVATTSPREITVDNKIQTDTQKPRGDVFIPRQP
SNDLFEIFEIERGVSADDEAKDDPGVLIHSCNFDHGLCGWIREKDSDVHWEPVRDPAGGQ
YLTVSAAKGPLGRAARLLLPLGHLLHAGDLCLSFRHKVTGLHSGTLQVLVRKHGAHGAAL
WGRNGGHGWRQTHITLRGADIKSVIFKGEKRHGHTGEIGLDDVSLKKGHCSEE
Download sequence
Identical sequences E1BBK6
ENSBTAP00000029938 ENSBTAP00000029938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]