SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000030635 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000030635
Domain Number 1 Region: 461-710
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.73e-58
Family Eukaryotic proteases 0.0000328
Further Details:      
 
Domain Number 2 Region: 368-462
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-33
Family Kringle modules 0.00013
Further Details:      
 
Domain Number 3 Region: 281-365
Classification Level Classification E-value
Superfamily Kringle-like 1.26e-30
Family Kringle modules 0.00017
Further Details:      
 
Domain Number 4 Region: 106-190
Classification Level Classification E-value
Superfamily Kringle-like 8.94e-30
Family Kringle modules 0.00028
Further Details:      
 
Domain Number 5 Region: 20-107
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 4.51e-17
Family Hairpin loop containing domain 0.02
Further Details:      
 
Domain Number 6 Region: 190-231
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000022
Family Kringle modules 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000030635   Gene: ENSBTAG00000011585   Transcript: ENSBTAT00000030663
Sequence length 712
Comment pep:known_by_projection chromosome:UMD3.1:22:51080758:51085659:1 gene:ENSBTAG00000011585 transcript:ENSBTAT00000030663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGWLPLLLLLIWFSGAPGQRSPLNDFQVLRGTELQHLLHSVGPGPWQEDVANAEECAGLC
GPLLDCRAFHYNLSSHGCQLLPWTQHSPHTRLQRSGRCDLFQKKNYVRTCIVDNGVEYRG
TVAITVGGLPCQRWSHRFPNDHKFTPTLRNGLEENFCRNPDRDPGGPWCYTTDPAVRFQS
CGIKSCREATCLWCNGEDYRGSVDSTESGRECQRWDLQHPHPHPFEPGFWTKIWTTTIAG
IRTARSGPGAIPPTRRWRESSATSPAAVQRSEAQPSQEATTLNCFRGKGEGYRGTVNTTA
AGVPCQRWDAQLPHQHRFAPEKYACKDLRENFCRNPDGSEAPWCFTSRPGMRMAFCYQIR
RCTDDVRPEDCYHGAGELYRGSVSKTRKGIRCQNWSAETPHKPQFKHTSAPHTPLEENFC
RNPDGDSHGPWCYTTDPGTPFDYCALRRCDDDQQPSILETAHQVLFDKCGKRVTRVDPLH
SKLRVVGGQPGNSPWTVSLRNRQGQHFCGGSLVKEQWVLTARQCFSSCHMSLVGYEVWLG
TLFQDPQPGEPDLQHIPMAKMVCGPSGSQLVLLKLERPVILNQRVALICLPPERYVVPPG
TRCEIAGWGETKGTGDDTVLNIALLSVISNQECNVKHRGRVRESEMCTAGLLAPVGACEG
DYGGPLACFTHDCWVLQGIIIPNRVCARPRWPAIFMRVSVFVDWIHKVMRLG
Download sequence
Identical sequences E1BDW7
ENSBTAP00000030635 ENSBTAP00000030635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]