SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031247 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031247
Domain Number 1 Region: 62-252
Classification Level Classification E-value
Superfamily L domain-like 2.01e-29
Family Ngr ectodomain-like 0.0014
Further Details:      
 
Domain Number 2 Region: 260-345
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000132
Family I set domains 0.013
Further Details:      
 
Domain Number 3 Region: 430-499
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000279
Family Fibronectin type III 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031247   Gene: ENSBTAG00000003442   Transcript: ENSBTAT00000031291
Sequence length 622
Comment pep:known chromosome:UMD3.1:28:39516530:39527943:-1 gene:ENSBTAG00000003442 transcript:ENSBTAT00000031291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVVVGMLWLLALGGPPQAQGACPSQCSCSLHVLSDGSKARTVVCNDPDMTLPPASVPLD
TSKLRLERTAIRRVPGDAFKTLGRLEQLWLPYNALCELSALMLRGLRRLRELRMPGNRLA
AFPWAALRDAPQLRLLDLQANRLSAVPPEAARFLGNLTFLDLSSNQLLRLPQELLATWIH
LHTGPFLPGHHARLVLGLQDNPWVCDCRLYDLVHFLEGWAPNLAFIEARLRCASPRSLAG
VVFSQLELRKCQSPELHPGMTSIRSPLGSRVLLRCGATGVPGPEMSWSRANGHPLNGTVH
QEVSSDGTSWALLGLPAVSQLDSGDYICQAKNFLGASETLISLVVTEPQTSTERSGGPGA
RWARTGEGAEAAAYNKMVARHVPHVPEPGVPATGPPVPNAKEQLFLQHFQMRPPEEHSDV
PAGSHEAQTVSSLKVVGDTYQSVTLVWKAPQAGNTTALSVLYAVFGKRDMRRVLVQPGKT
SVTIRGLVPKVKYVACVCVRGLVPRKEQCVIFSTDEVVDAEATQRLINVVVISVAAVIAL
PLTLLVCCGAVRRRWRKCHAGGSAEATGAYVNLERLGHSEDGSEDLSQHSLSEADRLLSA
RSSLDSQAVGIRASRRINEYFC
Download sequence
Identical sequences E1BKZ2
9913.ENSBTAP00000031247 NP_001179044.1.59421 NP_001179044.1.76553 ENSBTAP00000031247 ENSBTAP00000031247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]