SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031396 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031396
Domain Number 1 Region: 44-180
Classification Level Classification E-value
Superfamily dUTPase-like 4.06e-49
Family dUTPase-like 0.000000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031396   Gene: ENSBTAG00000011998   Transcript: ENSBTAT00000031441
Sequence length 185
Comment pep:known chromosome:UMD3.1:10:62284071:62295576:-1 gene:ENSBTAG00000011998 transcript:ENSBTAT00000031441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGGAAPGKPAERRARTSESRRQMKEAQVVSPSKRARATEAGDMRLRFARLSEHATAPT
KGSARAAGYDLYSAYDYTVPPMEKVLVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAG
VIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQVLDDTERGSGGFG
STGSN
Download sequence
Identical sequences Q2NKU1
9913.ENSBTAP00000031396 NP_001071341.1.59421 NP_001071341.1.76553 XP_005892206.1.15283 XP_010837838.1.44457 ENSBTAP00000031396 ENSBTAP00000031396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]