SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031460 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031460
Domain Number 1 Region: 15-219
Classification Level Classification E-value
Superfamily vWA-like 4.6e-57
Family Integrin A (or I) domain 0.00036
Further Details:      
 
Domain Number 2 Region: 276-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-30
Family Laminin G-like module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031460   Gene: ENSBTAG00000015374   Transcript: ENSBTAT00000031507
Sequence length 1623
Comment pep:known_by_projection chromosome:UMD3.1:14:5154763:5353760:1 gene:ENSBTAG00000015374 transcript:ENSBTAT00000031507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLRGSVVAGLLWMLLLWSGDRGCQAQRAGCKTVHYDLVFVLDSSSSVGKENFEKVRQW
VANLVDTFEVGPERTRVGVVRYSDRPATAFELGRFGSRAAVRAAARQLAYHGGHTHTGDA
LRFITRHSFTPRAGGRPGDRAFKQVAILLTDGRSQDLVLPAATAARRAGIRIFAVGVGEA
LREELEEIASEPTAAHVFHVSDFDAIDKIRGKLRRRLCENVLCPSVRVEGDRFKHTNGGT
KEITGFDLMDLFSVKTLLGERENGAQSSYVRMGSFPVVQRTEDVFPQGLPDEYAFVTTFR
LRKPSRREDWYIWQVIDQYGIPQVSIRLDGENKAVEYSAVGAMKDAVRVVFRGPRVHDLF
DRDWHKVALSVQAQNASLYVDCALVQTLPLEERENIDIQGKTAIGKRLYDSVPVDFDLQR
VVIYCDSRHAELETCCDIPSGPCQVTVLTEPSPLPQPPPTSGSEQIGFLKTINCSCPPGE
KGEKGFDGPVGLPGPKGDMGATGPAGAPGPKGEKGDTGGGPFVQGEKGEKGSLGLPGPPG
RDGSKGMRGEPGEPGEPGLPGEVGLRGSQGPPGLPGPPGPIGAPGLHGERGEKGARGEKG
EQGLDGFPGKQGETGEQGRPGPPGEPGPRGEKGAVGPAGPPGLPGSVVQREGLKGEQGAP
GPRGHQGPPGPPGAPGLMGPEGKDGPPGLQGLRGKRGEAGPPGVPGLLGQQGPPGPPGVP
GPPGPGGPPGLPGEIGFPGKPGPPGQAGPPGKDGPNGPPGLPGPKGDPGDRGEDGLPGQR
GPRGEVGEQGLAGRPGEKGEAGLPGFPGLPGARGEKGDQGEKGALGLPGLKGDQGVKGEV
GPPGPPGLPGTTSLFTPHPRMPGEPGPRGEKGDPGVPGEPGSPGHPGELGPRGPTGPPGA
KGQEGAQGAPGAAGSPGVPGLVGPPGPSGPPGSVGPPGSRGPPGKDGERGEKGAAGEEGS
PGPAGPRGDPGSPGPPGPPGRGKDGDPGLRGPPGLPGPLGTKDTYIKVRRSETMGGWCLK
GDRGAPGIPGSPGNRGEPGMAVAGPPGPSGPPGEKGPPGSRGPPGFPGPQGPAGQDGIPG
NPGERGPPGKPGPSSVLSPGDVNLLVKDVCNDCPPGPPGLPGLPGFKGDKGLPGKPGREG
TEGKKGDAGPRGLPGPPGIAGPQGNKGEHGADGEVGQKGDQGHPGVPGFMGPPGDPGPPG
ADGIAGTAGPPGIQGPPGKEGPPGPQGPSGLPGIPGEEGKEGRDGKPGPPGEPGKTGEPG
LPGPEGARGPPGFKGHTGDSGPPGPRGEPGATGPPGREGSPGKDGDTGPTGPQGPQGLRG
LPGKSGSPGSPGEPGTPGSPGQKGTKGENGSPGLPGFLGPRGPQGEPGEKGVPGKEGAPG
KPGEPGLRGERGDPGIKGDKGPPGGKGQPGDPGTPGHKGHTGLMGPQGPPGESGPAGPPG
PPGQPGFPGLRGESPSMDILRRLIQEELEKQLETKLAYLLAQMPSAHTKPSQGRPGPPGP
PGKDGLPGRAGPVGEPGRPGQGGLEGPSGPIGPKGERGAKGDPGAPGVGLRGEMGPPGIP
GQPGEPGYAKDGLPGSPGPQGETGPAGHPGPPGPPGPPGQCDPSQCAYFASLAAARPGNV
KGP
Download sequence
Identical sequences E1BG60
ENSBTAP00000031460 ENSBTAP00000031460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]