SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000031988 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000031988
Domain Number 1 Region: 24-221
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-52
Family F-box associated region, FBA 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000031988   Gene: ENSBTAG00000014296   Transcript: ENSBTAT00000032046
Sequence length 224
Comment pep:known_by_projection chromosome:UMD3.1:18:49184591:49189071:1 gene:ENSBTAG00000014296 transcript:ENSBTAT00000032046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WDQACEGEWAPPRGSLELPPRLTWKLLFLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQQ
PLEALGNFRGWHIRTEKLQQNLRLGGMPQMTALPLALSHSWTVKQQCVDLLAEGLWEELL
DDEQPRITVMDWFEDSRLDACVYELHVWLLAADRSTVIAQHHVAPRTSGRGPPGHWIQVS
HVFRQYGPGVRFVHFLHKTKNRMERGGLRRTRVTDSSVSVQFRE
Download sequence
Identical sequences G3X7J1
ENSBTAP00000031988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]