SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032103 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032103
Domain Number 1 Region: 314-475
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-39
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 23-135
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family V set domains (antibody variable domain-like) 0.00013
Further Details:      
 
Domain Number 3 Region: 111-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000204
Family C1 set domains (antibody constant domain-like) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032103   Gene: ENSBTAG00000023563   Transcript: ENSBTAT00000032165
Sequence length 476
Comment pep:novel chromosome:UMD3.1:23:26916511:26927031:-1 gene:ENSBTAG00000023563 transcript:ENSBTAT00000032165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACVLRCFYVCSSLTLVSVSTEEFTVIAPPDPIVAVLGGEVLLPCRVSPAMSAEDMELRWF
RSKFSEAVFIYQDRLEQKEEQMAPYAGRTSLVRDLLIQGEAAVRIQNVSVSDNGLYTCFF
RKGGFYEEASLELKVAGVGSAPQVRITGPEEDGVRVVCTASGWFPKPQVQWRDLSGEKFL
AFSEAHTQDTEGLFSVEAALVVRDSSVGNVTCSILNPVLGQEKAMAIFIPEPFFPQASPW
KVAFSVSLTVLVILLLGAGCYTKRQHSMKMQTSEQDRQTKEELLKDAGKEELERRKSAYL
AAWRKAQLYADWRKEEFQEWPVTLDPKTSVTLKTSCVNAADKCSVLGFEGITSGRCYWEV
EIRDGDQSEWFLGVCGEGVNRKGWYVESPGKEFWAVGRFERGYCVCTVPQILVSLMQAPH
PRLRVGVFLDHQEGDISFYNMTDGSHIFSFPQASFSGTLFPYFMISSGNVSLTVCS
Download sequence
Identical sequences F1MX97
ENSBTAP00000032103 ENSBTAP00000032103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]