SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032513 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032513
Domain Number 1 Region: 573-729
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.25e-34
Family MAM domain 0.00097
Further Details:      
 
Domain Number 2 Region: 887-1051
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.17e-32
Family MAM domain 0.0024
Further Details:      
 
Domain Number 3 Region: 63-220
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.44e-28
Family MAM domain 0.01
Further Details:      
 
Domain Number 4 Region: 732-885
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.01e-27
Family MAM domain 0.0014
Further Details:      
 
Domain Number 5 Region: 270-423
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-18
Family MAM domain 0.013
Further Details:      
 
Domain Number 6 Region: 224-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 7 Region: 487-571
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000253
Family MAM domain 0.01
Further Details:      
 
Domain Number 8 Region: 453-492
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000275
Family LDL receptor-like module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032513   Gene: ENSBTAG00000021550   Transcript: ENSBTAT00000032582
Sequence length 1133
Comment pep:known chromosome:UMD3.1:11:106325456:106332942:-1 gene:ENSBTAG00000021550 transcript:ENSBTAT00000032582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLHGHLLPAVVMLLAGSPGWAWVPNHCRTPREAVCNFVCDCRGCPDEAQCGYHGTSPSL
GTPFTCDFERDSCGWRDISTAGYRWLRDRAGASPERPGLRADHTLGTDLGWYVAVGTHRG
RETATAALRSPVLHEAAPTCELRLWYHVASGDVAELRLELTHGVETLTLWQSAGPWDPDW
QELAVPTGRIRGAFRVTFSATRNATHRGTVALDDVAFWRCGLPTPQAHCPRGHHRCQNEA
CVEPAQLCDGEDNCGDHSDEDAAPCRHYIATDFEMGLGLWNHSEGWTRNHSAGGPRYPAW
PRGDHTWNSAQGSFLASVAEPSTPAVLSSPEFQASAPHNCSLVFYHYLHGSEAGCLQVFL
QTASPAAPQTPVLLRRRHGELGAAWVRDRVDIQSEHPFRILLAGQTGPGGVVGLDDLILS
NHCKPIPELAGPPPGCWAPGPWPQPPSLRPRSFCEPGHFFCGDLCVPPEQLCDFQQQCPG
GEDEQECGTTDFESLSGGGWEDASVGRLQWVRLPAPDRGMPSPDAHGAAGHFLAVQRAWG
QLAEEARALTPTLGPSGPRCELRLVYYLQSHPREVSCNFERGACGWHTGHLTDAHWHRVE
SRGPRYDHTTGQGHFVLLDPVDPPARGPAAHLLTQPRVPSAPQECLSFWFHLFGPQIGTL
RLAMRREGEAETHLWSRSGTHGNCWHEAWATLHHQPDSGAKYQLLFEGLRDGYHGSMALD
DVTLRPGPCWAPRRCSFEDSACGFSVGGRGLWTRQANASWGPHADHTTETAQGHYMVVDM
SPQALPRGHAALLTSEEQRPLVQPTCLTFWYHLSLRNPGTLRVHVEEAGRQQVLSVSSRG
GAAWRLGSVDLQAGQAWRVVFEAVAAGVEHSYVALDDLLLQDGPCPLPASCDFEAGLCGW
NHVPRPGLGGYSWDWSSGASPSRYPQPPVDHTLGTEAGHFALFETSVLGPGGRAAGLISQ
PLPPTTASCLRFWYHMGFPEHFYQGELRVLLSSAQGQLAVWGAGGRHRHQWLEGQVDVAS
AREFQIVFEATLGGQPALGPIALDDVEYLAGQRCQLSTPSQGDGAAAAVVPAAVGGTLLL
LVLLMLLGVAGRRWLQKGGCPSWGKADTVTPGFDNILFSADRVTLPASVPHDQ
Download sequence
Identical sequences F1MKB1
NP_001137345.1.59421 NP_001137345.1.76553 ENSBTAP00000032513 ENSBTAP00000032513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]