SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000032951 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000032951
Domain Number 1 Region: 38-253
Classification Level Classification E-value
Superfamily L domain-like 1.51e-30
Family Ngr ectodomain-like 0.0043
Further Details:      
 
Domain Number 2 Region: 247-345
Classification Level Classification E-value
Superfamily Immunoglobulin 3.3e-18
Family I set domains 0.033
Further Details:      
 
Domain Number 3 Region: 364-432
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000322
Family Fibronectin type III 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000032951   Gene: ENSBTAG00000023987   Transcript: ENSBTAT00000033025
Sequence length 551
Comment pep:known_by_projection chromosome:UMD3.1:28:39505113:39510579:-1 gene:ENSBTAG00000023987 transcript:ENSBTAT00000033025 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVPHYFLLVLVFLDSHVAQPSCLPGCACSEESFGRTLKCVSISLGEIPRNLSEEFKQV
RIENSPVFELPRGFFINMHTLEYLWLNFDNVTVIHPGALEHLSELKELRLEGNKLRSVPW
TAFRATPLLRILDLKHNRIDALPELALQFLVNLTYLDLSSNRLTVVSKNVFLNWPAYQKH
RQSGHEAEMLSSMVLALHDNPWLCDCRLRGLVQFIKSISLPVILVNPYLMCRGPLFKAGQ
LFHETELSVCTKPQISTPSANVSVQVGQNVTLRCLAQASPSPTIAWTYPLSTWREFDVLT
SFTAEDATLSELVIPAAHLVDRGNYTCMASNPIGMSTVVISLRVQPAQALLAPRSVFSPS
ESSAYVDLRVVKQTVHGILLEWFAAADTPETWFTLYIASDEAFRKKVVHVGPGINTYTVD
DLLPGTKYEICLSLGGQPPRQGRCVVFVTGRDDGGLEGRERLLHTTVILCAVLLAVPVGA
YAWAAQAPCSCRGWGQRWCLHRRKAPRCPQAVPEHRDDPYRDHTAVCEDGLGPGGADPEG
DEQRAGEGDDH
Download sequence
Identical sequences E1B978
ENSBTAP00000032951 ENSBTAP00000032951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]