SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033182 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033182
Domain Number 1 Region: 635-928
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.67e-65
Family Protein kinases, catalytic subunit 0.0000000468
Further Details:      
 
Domain Number 2 Region: 35-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-65
Family Ephrin receptor ligand binding domain 0.00000298
Further Details:      
 
Domain Number 3 Region: 337-534
Classification Level Classification E-value
Superfamily Fibronectin type III 1.05e-25
Family Fibronectin type III 0.00044
Further Details:      
 
Domain Number 4 Region: 932-1005
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.19e-17
Family SAM (sterile alpha motif) domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033182   Gene: ENSBTAG00000020510   Transcript: ENSBTAT00000033263
Sequence length 1008
Comment pep:known chromosome:UMD3.1:3:108737032:108777675:1 gene:ENSBTAG00000020510 transcript:ENSBTAT00000033263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METGAGPHPLRLFICLMPLCLALLLGPGRPGTAEEVILLDSKASQAELGWTALPSNGWEE
ISGVDEHDRPIRTYQVCNVLEPNQDNWLQTGWIGRGRGQRIFVELQFTLRDYSSIPGAAG
TCKETFNVYYLETEADLGRGRTRPGGSRPRKIDTIAADESFTQGDLGERKMKLNTEVREI
GPLSRQGFHLAFQDVGACVALVSVRVYYKQCRATVRGLAAFPATAAESAFSTLVEVTGTC
VAHSEGEPGSPPRMHCGADGEWLVPVGRCSCSAGFQERGDICEACPPGFYKVSPRRPLCS
PCPEHSRALENASTFCVCQDSYARSPTDPPSASCTRPPSAPRDLQYSLSRSPLALRLRWL
PPADSGGRSDVTYSLLCLRCGREGPAGACEPCGPRVAFVPRQVGLRERAATLLHLRPGAR
YTVRVAALNGVSGPAAAAGATYAQVTVSTGPGAPWEEDEIRRDRVEPQSVSLSWREPIPA
GAPGANGTEYEIRYFEKGQSEQTYSTVKTGAPAVTVTNLKPATRYVFQIRAASPGPSWET
QSFNPSIEVLTPGEATSRSKDQSPAVVVTVVTISALLVLGSVMSVLAIWRRPCSYGKGGR
DAHDEEELYFHFKVPTRRTFVDPQSCGDPLQAVHLFAKELDAKSVTLEKSLGTGRFGELC
CGCLQLPGRQELPVAVHTLREGCSDSQRLSFLAEALTLGQFDHSHVVRLEGVVTRGSTLM
IVIEYMSHGALDGFLRRHEGQLVAAQLMGLLPGLASAMKYLSEMGYVHRGLAARRVLVSS
ELVCKISGFGRGPRDRAEAVYTTMSGRSPALWAAPETLQFGHFSSASDVWSFGVVMWEVM
AFGERPYWDMSGQDVIKAVEDGFRLPPPRNCPSPLHRLMLDCWQKDPGERPRFSQIHGLL
SKMMQDPEPPRCADTTCARPPTPLEDRAFSTFPSFGSVGAWLEALDLGRYKDSFAAAGYG
SLEAVAAMTAQDLVSLGISSAEHREDLLSGISALRARVLQLQGRGVQV
Download sequence
Identical sequences F1N6H6
ENSBTAP00000033182 ENSBTAP00000033182 NP_001192751.1.59421 NP_001192751.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]