SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033248 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033248
Domain Number 1 Region: 23-203,309-346
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-56
Family Calnexin/calreticulin 0.00023
Further Details:      
 
Domain Number 2 Region: 203-313
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 1.24e-36
Family P-domain of calnexin/calreticulin 0.00000907
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033248   Gene: ENSBTAG00000024153   Transcript: ENSBTAT00000033333
Sequence length 421
Comment pep:novel chromosome:UMD3.1:3:95327045:95349925:1 gene:ENSBTAG00000024153 transcript:ENSBTAT00000033333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRMLLCLYAIYAKAKQIYQHLFETAEFNPIDGWKKRWVVSKHGSYGKFQLTGGKFYGDKE
KDKGLQSSEDAKFYALSTRFKPFSNENETLVVQFSVKHKQGVDCGGGYMKLFPDTMNQED
MHSELEYYIMFGPDICGFGNNKVQVILHYQGKYHENNKTIKCRINKDTHPYTLIIHPSAT
YEVKIDNKQVEAGELEDDWTFLPPKIKNPYAQKPRKWDEQLQIEDGEDKKPEDWEDFEYI
PDPEAEKPDDWNEAMDGEWEGPLIPNVKYKGKWKPRIIDNSKYQGEWIHPEIDNPEYKPD
PSICHYYNISVLGLDLWQVKSGSIFDNFLPTNDEEFAEEVGNMTWGTRKSPHLALKTTQQ
DEEMEKRKWEEEAKKKEEREYDIWGTEEEGSEEDSAEEPGNDRQLKEDDDERAFLGENVE
V
Download sequence
Identical sequences F1N621
ENSBTAP00000033248 ENSBTAP00000033248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]