SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033341 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033341
Domain Number 1 Region: 18-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.32e-40
Family Ephrin receptor ligand binding domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 404-532
Classification Level Classification E-value
Superfamily Fibronectin type III 2.22e-25
Family Fibronectin type III 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033341   Gene: ENSBTAG00000015510   Transcript: ENSBTAT00000033428
Sequence length 604
Comment pep:known chromosome:UMD3.1:4:106989816:106993917:1 gene:ENSBTAG00000015510 transcript:ENSBTAT00000033428 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSLWVLALVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEAC
HVAGAAPGLGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVAGGTCRETFTLYYRQA
EEPDGPDSISSWHLKRWTKVDTIAADESFPASSAWAVGPPRAGQRAGLQLNVKERRALNP
ARLLRGFPGHGGLPGVAVKLFSYACPSVLRAFASFPETQASGAGPPWWRPWAPVWHTRSR
RRMEQGARQRAAPPGCTATGRASGWLPSGAAAASQGTSLRGETRPAKPALGGPTKPWLGM
PPAHHALPAATPWPLPCVPLPGGLLPGQFRPPRGSLHWPTVSPPGAVVRGAGLRPHAALA
PASGAWGPRGPAFQRGVQGVRRGRQGPCRRCRDEVHFDPRQRGLTESRVLIGGLRPHVPY
ILEVQAVNGVSELSPDPPQAAAINVSTSHAVPSAVPAVHQVSRASNSITVSWPQPDQTNG
NILDYQLRYYDQAEDESHSFTLTSETNTATVTKLSPGHIYGFQVRARTAAGHPMGARSTS
RRCLKVSCPLNFLRGFPWWLGPSWGRWPSFCWRPSPCWLSSSRGSGVEPATWNNCSSTAA
QVGV
Download sequence
Identical sequences F1N5D4
ENSBTAP00000033341 ENSBTAP00000033341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]