SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSBTAP00000033527 from Bos taurus 76_3.1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSBTAP00000033527
Domain Number 1 Region: 14-112
Classification Level Classification E-value
Superfamily DNA clamp 0.000000286
Family DNA polymerase processivity factor 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSBTAP00000033527   Gene: ENSBTAG00000013226   Transcript: ENSBTAT00000033617
Sequence length 182
Comment pep:known_by_projection chromosome:UMD3.1:4:75146925:75159359:1 gene:ENSBTAG00000013226 transcript:ENSBTAT00000033617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKFRAKIVDTACLNHFTRVSNMIAKLAKTCTLRISPDKLNFILSDRVANGGVSMWCELEQ
ENFFSEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSIELL
SVSSSSRVVTHDIPVKVIPRKLWKDLQEPTVPDADVSIYLPVLKTMKSVVEKMKNISNHL
IL
Download sequence
Identical sequences F1N1T7
ENSBTAP00000033527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]